In the modern world, it is often necessary to integrate different tools to work together.
CVAT provides the following integration layers:
Server REST API + Swagger schema
Python client library (SDK)
REST API client
High-level wrappers
Command-line tool (CLI)
In this section, you can find documentation about each separate layer.
Component compatibility
Currently, the only supported configuration is when the server API major and minor versions
are the same as SDK and CLI major and minor versions, e.g. server v2.1.* is supported by
SDK and CLI v2.1.*. Different versions may have incompatibilities, which lead to some functions
in SDK or CLI may not work properly.
1 - Server API
Overview
CVAT server provides HTTP REST API for interaction. Each client application - be it
a command line tool, browser or a script - all interact with CVAT via HTTP requests and
responses:
API schema
You can obtain schema for your server at <yourserver>/api/docs. For example,
the official CVAT.ai application has API documentation here.
Examples
Here you can see how a task is created in CVAT:
At first, we have to login
Then we create a task from its configuration
Then we send task data (images, videos etc.)
We wait for data processing and finish
Design principles
Common pattern for our REST API is <VERB> [namespace] <objects> <id> <action>.
VERB can be POST, GET, PATCH, PUT, DELETE.
namespace should scope some specific functionality like auth, lambda.
It is optional in the scheme.
Typical objects are tasks, projects, jobs.
When you want to extract a specific object from a collection, just specify its id.
An action can be used to simplify REST API or provide an endpoint for entities
without objects endpoint like annotations, data, data/meta. Note: action
should not duplicate other endpoints without a reason.
When you’re developing new endpoints, follow these guidelines:
Use nouns instead of verbs in endpoint paths. For example,
POST /api/tasks instead of POST /api/tasks/create.
Accept and respond with JSON whenever it is possible
Name collections with plural nouns (e.g. /tasks, /projects)
Try to keep the API structure flat. Prefer two separate endpoints
for /projects and /tasks instead of /projects/:id1/tasks/:id2. Use
filters to extract necessary information like /tasks/:id2?project=:id1.
In some cases it is useful to get all tasks. If the structure is
hierarchical, it cannot be done easily. Also you have to know both :id1
and :id2 to get information about the task.
Note: for now we accept GET /tasks/:id2/jobs but it should be replaced
by /jobs?task=:id2 in the future.
Handle errors gracefully and return standard error codes (e.g. 201, 400)
Allow filtering, sorting, and pagination
Maintain good security practices
Cache data to improve performance
Versioning our APIs. It should be done when you delete an endpoint or modify
its behaviors. Versioning uses a schema with Accept header with vendor media type.
Playground
Sometimes, it may be necessary to send customized requests or
simply test some endpoints available on the server.
It’s possible to send custom requests to a CVAT server directly from
your web browser without special extensions. This can be done at
the Swagger page provided by the server. The page is available at
<cvat_host>/api/swagger (e.g. https://app.cvat.ai/api/swagger).
The Swagger page provides the autogenerated documentation,
supports multiple authentication options and allows sending
custom requests to various server endpoints.
Swagger documentation is visible on allowed hosts. If necessary, the list can be modified by updating the environment
variable in docker-compose.ymlfile with cvat hosted machine IP or domain
name. Example - ALLOWED_HOSTS: 'localhost, 127.0.0.1'.
Make a request to a resource stored on a server and the server will respond with the requested information.
The endpoints are grouped by APIs:
auth - user authentication queries
comments - requests to post/delete comments to issues
issues - update, delete and view problem comments
jobs -requests to manage the job
lambda - requests to work with lambda function
projects - project management queries
reviews -adding and removing the review of the job
server - server information requests
tasks - requests to manage tasks
users - user management queries
etc.
In the Models section below you can also find various data
structures used in the endpoints.
Each group contains queries related to a different types of HTTP methods such as: GET, POST, PATCH, DELETE, etc.
Different methods are highlighted in different color. Each item has a name and description.
Clicking on an element opens a form with a name, description and settings input field or an example of json values.
CVAT SDK is a Python library. It provides you access to Python functions and objects that
simplify server interaction and provide additional functionality like data validation
and serialization.
SDK API includes several layers:
Low-level API with REST API wrappers. Located at cvat_sdk.api_client.
Read more
High-level API. Located at cvat_sdk.core.
Read more
PyTorch adapter. Located at cvat_sdk.pytorch.
Read more
Auto-annotation API. Located at cvat_sdk.auto_annotation.
Read more
Miscellaneous utilities, grouped by topic.
Located at cvat_sdk.attributes and cvat_sdk.masks.
In general, the low-level API provides single-request operations, while the high-level one
implements composite, multi-request operations, and provides local proxies for server objects.
For most uses, the high-level API should be good enough, and it should be
the right point to start your integration with CVAT.
The PyTorch adapter is a specialized layer
that represents datasets stored in CVAT as PyTorch Dataset objects.
This enables direct use of such datasets in PyTorch-based machine learning pipelines.
The auto-annotation API is a specialized layer
that lets you automatically annotate CVAT datasets
by running a custom function on the local machine.
See also the auto-annotate command in the CLI.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:guide_id=1# int | file=open('/path/to/file','rb')# file_type | try:(data,response)=api_client.assets_api.create(guide_id,file,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AssetsApi.create(): %s\n"%e)
Parameters
Name
Type
Description
Notes
guide_id
int
file
file_type
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AssetRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:uuid="uuid_example"# str | A UUID string identifying this asset.try:api_client.assets_api.destroy(uuid,)exceptexceptions.ApiExceptionase:print("Exception when calling AssetsApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
uuid
str
A UUID string identifying this asset.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:uuid="uuid_example"# str | A UUID string identifying this asset.try:api_client.assets_api.retrieve(uuid,)exceptexceptions.ApiExceptionase:print("Exception when calling AssetsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
uuid
str
A UUID string identifying this asset.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:access_token_write_request=AccessTokenWriteRequest(name="name_example",expiry_date=dateutil_parser('1970-01-01T00:00:00.00Z'),read_only=True,)# AccessTokenWriteRequest | try:(data,response)=api_client.auth_api.create_access_tokens(access_token_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.create_access_tokens(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AccessTokenRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Check the credentials and return the REST Token if the credentials are valid and authenticated. If email verification is enabled and the user has the unverified email, an email with a confirmation link will be sent. Calls Django Auth login method to register User ID in Django session framework. Accept the following POST parameters: username, email, password Return the REST Framework Token Object’s key.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:login_serializer_ex_request=LoginSerializerExRequest(username="username_example",email="email_example",password="password_example",)# LoginSerializerExRequest | try:(data,response)=api_client.auth_api.create_login(login_serializer_ex_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.create_login(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[Token, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Calls Django logout method and delete the Token object assigned to the current User object. Accepts/Returns nothing.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:try:(data,response)=api_client.auth_api.create_logout()pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.create_logout(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RestAuthDetail, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Calls Django Auth SetPasswordForm save method. Accepts the following POST parameters: new_password1, new_password2 Returns the success/fail message.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:password_change_request=PasswordChangeRequest(old_password="old_password_example",new_password1="new_password1_example",new_password2="new_password2_example",)# PasswordChangeRequest | try:(data,response)=api_client.auth_api.create_password_change(password_change_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.create_password_change(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RestAuthDetail, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Calls Django Auth PasswordResetForm save method. Accepts the following POST parameters: email Returns the success/fail message.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:password_reset_serializer_ex_request=PasswordResetSerializerExRequest(email="email_example",)# PasswordResetSerializerExRequest | try:(data,response)=api_client.auth_api.create_password_reset(password_reset_serializer_ex_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.create_password_reset(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RestAuthDetail, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Password reset e-mail link is confirmed, therefore this resets the user’s password. Accepts the following POST parameters: token, uid, new_password1, new_password2 Returns the success/fail message.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:password_reset_confirm_request=PasswordResetConfirmRequest(new_password1="new_password1_example",new_password2="new_password2_example",uid="uid_example",token="token_example",)# PasswordResetConfirmRequest | try:(data,response)=api_client.auth_api.create_password_reset_confirm(password_reset_confirm_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.create_password_reset_confirm(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RestAuthDetail, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Registers a new user. Accepts the following POST parameters: username, email, password1, password2.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:register_serializer_ex_request=RegisterSerializerExRequest(username="username_example",email="email_example",password1="password1_example",password2="password2_example",first_name="first_name_example",last_name="last_name_example",)# RegisterSerializerExRequest | try:(data,response)=api_client.auth_api.create_register(register_serializer_ex_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.create_register(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RegisterSerializerEx, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this API Access Token.try:api_client.auth_api.destroy_access_tokens(id,)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.destroy_access_tokens(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this API Access Token.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['created_date', 'expiry_date', 'id', 'last_used_date', 'name', 'read_only', 'updated_date']. (optional)name="name_example"# str | A simple equality filter for the name field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)read_only=True# bool | A simple equality filter for the read_only field (optional)search="search_example"# str | A search term. Available search_fields: ['name'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['created_date', 'expiry_date', 'id', 'last_used_date', 'name', 'read_only', 'updated_date'] (optional)try:(data,response)=api_client.auth_api.list_access_tokens(filter=filter,name=name,page=page,page_size=page_size,read_only=read_only,search=search,sort=sort,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.list_access_tokens(): %s\n"%e)
Parameters
Name
Type
Description
Notes
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘created_date’, ’expiry_date’, ‘id’, ’last_used_date’, ’name’, ‘read_only’, ‘updated_date’].
[optional]
name
str
A simple equality filter for the name field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
read_only
bool
A simple equality filter for the read_only field
[optional]
search
str
A search term. Available search_fields: [’name’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘created_date’, ’expiry_date’, ‘id’, ’last_used_date’, ’name’, ‘read_only’, ‘updated_date’]
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedAccessTokenReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this API Access Token.patched_access_token_write_request=PatchedAccessTokenWriteRequest(name="name_example",expiry_date=dateutil_parser('1970-01-01T00:00:00.00Z'),read_only=True,)# PatchedAccessTokenWriteRequest | (optional)try:(data,response)=api_client.auth_api.partial_update_access_tokens(id,patched_access_token_write_request=patched_access_token_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.partial_update_access_tokens(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this API Access Token.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AccessTokenRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this API Access Token.try:(data,response)=api_client.auth_api.retrieve_access_tokens(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.retrieve_access_tokens(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this API Access Token.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AccessTokenRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Get details of the token used for the current request. This endpoint is only allowed if the request is performed using an access token.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",)withApiClient(configuration)asapi_client:try:(data,response)=api_client.auth_api.retrieve_access_tokens_self()pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.retrieve_access_tokens_self(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AccessTokenRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Authentication
accessTokenAuth
HTTP request headers
Content-Type: Not defined
Accept: application/vnd.cvat+json
HTTP response details
Status code
Description
Response headers
200
-
retrieve_rules
retrieve_rules(
**kwargs
)
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",)withApiClient(configuration)asapi_client:try:api_client.auth_api.retrieve_rules()exceptexceptions.ApiExceptionase:print("Exception when calling AuthApi.retrieve_rules(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:cloud_storage_write_request=CloudStorageWriteRequest(provider_type=ProviderTypeEnum("AWS_S3_BUCKET"),resource="resource_example",display_name="display_name_example",owner=BasicUserRequest(username="A",first_name="first_name_example",last_name="last_name_example",),credentials_type=CredentialsTypeEnum("KEY_SECRET_KEY_PAIR"),session_token="session_token_example",account_name="account_name_example",key="key_example",secret_key="secret_key_example",connection_string="connection_string_example",key_file=open('/path/to/file','rb'),specific_attributes="specific_attributes_example",description="description_example",manifests=[],)# CloudStorageWriteRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.cloudstorages_api.create(cloud_storage_write_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.create(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[CloudStorageRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this cloud storage.try:api_client.cloudstorages_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this cloud storage.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)credentials_type="KEY_SECRET_KEY_PAIR"# str | A simple equality filter for the credentials_type field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['credentials_type', 'description', 'id', 'name', 'owner', 'provider_type', 'resource']. (optional)name="name_example"# str | A simple equality filter for the name field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)owner="owner_example"# str | A simple equality filter for the owner field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)provider_type="AWS_S3_BUCKET"# str | A simple equality filter for the provider_type field (optional)resource="resource_example"# str | A simple equality filter for the resource field (optional)search="search_example"# str | A search term. Available search_fields: ['description', 'name', 'owner', 'resource'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['credentials_type', 'description', 'id', 'name', 'owner', 'provider_type', 'resource'] (optional)try:(data,response)=api_client.cloudstorages_api.list(x_organization=x_organization,credentials_type=credentials_type,filter=filter,name=name,org=org,org_id=org_id,owner=owner,page=page,page_size=page_size,provider_type=provider_type,resource=resource,search=search,sort=sort,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
credentials_type
str
A simple equality filter for the credentials_type field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘credentials_type’, ‘description’, ‘id’, ’name’, ‘owner’, ‘provider_type’, ‘resource’].
[optional]
name
str
A simple equality filter for the name field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
owner
str
A simple equality filter for the owner field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
provider_type
str
A simple equality filter for the provider_type field
[optional]
resource
str
A simple equality filter for the resource field
[optional]
search
str
A search term. Available search_fields: [‘description’, ’name’, ‘owner’, ‘resource’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘credentials_type’, ‘description’, ‘id’, ’name’, ‘owner’, ‘provider_type’, ‘resource’]
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedCloudStorageReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this cloud storage.patched_cloud_storage_write_request=PatchedCloudStorageWriteRequest(provider_type=ProviderTypeEnum("AWS_S3_BUCKET"),resource="resource_example",display_name="display_name_example",owner=BasicUserRequest(username="A",first_name="first_name_example",last_name="last_name_example",),credentials_type=CredentialsTypeEnum("KEY_SECRET_KEY_PAIR"),session_token="session_token_example",account_name="account_name_example",key="key_example",secret_key="secret_key_example",connection_string="connection_string_example",key_file=open('/path/to/file','rb'),specific_attributes="specific_attributes_example",description="description_example",manifests=[],)# PatchedCloudStorageWriteRequest | (optional)try:(data,response)=api_client.cloudstorages_api.partial_update(id,patched_cloud_storage_write_request=patched_cloud_storage_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.partial_update(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this cloud storage.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[CloudStorageRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this cloud storage.try:(data,response)=api_client.cloudstorages_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this cloud storage.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[CloudStorageRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Method return allowed actions for cloud storage. It’s required for reading/writing
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this cloud storage.try:(data,response)=api_client.cloudstorages_api.retrieve_actions(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.retrieve_actions(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this cloud storage.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[str, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this cloud storage.manifest_path="manifest_path_example"# str | Path to the manifest file in a cloud storage (optional)next_token="next_token_example"# str | Used to continue listing files in the bucket (optional)page_size=1# int | (optional)prefix="prefix_example"# str | Prefix to filter data (optional)try:(data,response)=api_client.cloudstorages_api.retrieve_content_v2(id,manifest_path=manifest_path,next_token=next_token,page_size=page_size,prefix=prefix,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.retrieve_content_v2(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this cloud storage.
manifest_path
str
Path to the manifest file in a cloud storage
[optional]
next_token
str
Used to continue listing files in the bucket
[optional]
page_size
int
[optional]
prefix
str
Prefix to filter data
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[CloudStorageContent, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this cloud storage.try:api_client.cloudstorages_api.retrieve_preview(id,)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.retrieve_preview(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this cloud storage.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this cloud storage.try:(data,response)=api_client.cloudstorages_api.retrieve_status(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CloudstoragesApi.retrieve_status(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this cloud storage.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[str, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:comment_write_request=CommentWriteRequest(issue=1,message="message_example",)# CommentWriteRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.comments_api.create(comment_write_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CommentsApi.create(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[CommentRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this comment.try:api_client.comments_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling CommentsApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this comment.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['frame_id', 'id', 'issue_id', 'job_id', 'owner']. (optional)frame_id=1# int | A simple equality filter for the frame_id field (optional)issue_id=1# int | A simple equality filter for the issue_id field (optional)job_id=1# int | A simple equality filter for the job_id field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)owner="owner_example"# str | A simple equality filter for the owner field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)search="search_example"# str | A search term. Available search_fields: ['owner'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['frame_id', 'id', 'issue_id', 'job_id', 'owner'] (optional)try:(data,response)=api_client.comments_api.list(x_organization=x_organization,filter=filter,frame_id=frame_id,issue_id=issue_id,job_id=job_id,org=org,org_id=org_id,owner=owner,page=page,page_size=page_size,search=search,sort=sort,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CommentsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘frame_id’, ‘id’, ‘issue_id’, ‘job_id’, ‘owner’].
[optional]
frame_id
int
A simple equality filter for the frame_id field
[optional]
issue_id
int
A simple equality filter for the issue_id field
[optional]
job_id
int
A simple equality filter for the job_id field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
owner
str
A simple equality filter for the owner field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
search
str
A search term. Available search_fields: [‘owner’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘frame_id’, ‘id’, ‘issue_id’, ‘job_id’, ‘owner’]
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedCommentReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this comment.patched_comment_write_request=PatchedCommentWriteRequest(message="message_example",)# PatchedCommentWriteRequest | (optional)try:(data,response)=api_client.comments_api.partial_update(id,patched_comment_write_request=patched_comment_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CommentsApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[CommentRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this comment.try:(data,response)=api_client.comments_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling CommentsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this comment.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[CommentRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:consensus_merge_create_request=ConsensusMergeCreateRequest(task_id=1,job_id=1,)# ConsensusMergeCreateRequest | (optional)try:(data,response)=api_client.consensus_api.create_merge(consensus_merge_create_request=consensus_merge_create_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ConsensusApi.create_merge(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
A consensus merge request has been enqueued, the request id is returned. The request status can be checked by using common requests API: GET /api/requests/<rq_id>
-
400
Invalid or failed request, check the response data for details
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['id', 'task_id']. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['id'] (optional)task_id=1# int | A simple equality filter for the task_id field (optional)try:(data,response)=api_client.consensus_api.list_settings(x_organization=x_organization,filter=filter,org=org,org_id=org_id,page=page,page_size=page_size,sort=sort,task_id=task_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ConsensusApi.list_settings(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘id’, ’task_id’].
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘id’]
[optional]
task_id
int
A simple equality filter for the task_id field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedConsensusSettingsList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | An id of a consensus settings instancepatched_consensus_settings_request=PatchedConsensusSettingsRequest(iou_threshold=0,)# PatchedConsensusSettingsRequest | (optional)try:(data,response)=api_client.consensus_api.partial_update_settings(id,patched_consensus_settings_request=patched_consensus_settings_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ConsensusApi.partial_update_settings(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[ConsensusSettings, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | An id of a consensus settings instancetry:(data,response)=api_client.consensus_api.retrieve_settings(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ConsensusApi.retrieve_settings(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
An id of a consensus settings instance
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[ConsensusSettings, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:client_events_request=ClientEventsRequest(events=[EventRequest(scope="scope_example",obj_name="obj_name_example",obj_id=1,obj_val="obj_val_example",source="source_example",timestamp=dateutil_parser('1970-01-01T00:00:00.00Z'),count=1,duration=0,project_id=1,task_id=1,job_id=1,user_id=1,user_name="user_name_example",user_email="user_email_example",org_id=1,org_slug="org_slug_example",payload="payload_example",),],previous_event=ClientEventsRequestPreviousEvent(None),timestamp=dateutil_parser('1970-01-01T00:00:00.00Z'),)# ClientEventsRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.events_api.create(client_events_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling EventsApi.create(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[ClientEvents, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Desired output file name (optional)_from=dateutil_parser('1970-01-01T00:00:00.00Z')# datetime | UTC start date for events filtration. Default is the minimal time. (optional)job_id=1# int | Filter events by job ID (optional)location="cloud_storage"# str | Where need to save events file (optional)org_id=1# int | Filter events by organization ID (optional)project_id=1# int | Filter events by project ID (optional)task_id=1# int | Filter events by task ID (optional)to=dateutil_parser('1970-01-01T00:00:00.00Z')# datetime | UTC end date for events filtration. Default is the current time. (optional)user_id=1# int | Filter events by user ID (optional)try:(data,response)=api_client.events_api.create_export(cloud_storage_id=cloud_storage_id,filename=filename,_from=_from,job_id=job_id,location=location,org_id=org_id,project_id=project_id,task_id=task_id,to=to,user_id=user_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling EventsApi.create_export(): %s\n"%e)
Parameters
Name
Type
Description
Notes
cloud_storage_id
int
Storage id
[optional]
filename
str
Desired output file name
[optional]
_from
datetime
UTC start date for events filtration. Default is the minimal time.
[optional]
job_id
int
Filter events by job ID
[optional]
location
str
Where need to save events file
[optional]
org_id
int
Filter events by organization ID
[optional]
project_id
int
Filter events by project ID
[optional]
task_id
int
Filter events by task ID
[optional]
to
datetime
UTC end date for events filtration. Default is the current time.
[optional]
user_id
int
Filter events by user ID
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:action="download"# str | Used to start downloading process after annotation file had been created (optional) if omitted the server will use the default value of "download"filename="filename_example"# str | Desired output file name (optional)_from=dateutil_parser('1970-01-01T00:00:00.00Z')# datetime | UTC start date for events filtration. Default is the minimal time. (optional)job_id=1# int | Filter events by job ID (optional)org_id=1# int | Filter events by organization ID (optional)project_id=1# int | Filter events by project ID (optional)query_id="query_id_example"# str | ID of query request that need to check or download (optional)task_id=1# int | Filter events by task ID (optional)to=dateutil_parser('1970-01-01T00:00:00.00Z')# datetime | UTC end date for events filtration. Default is the current time. (optional)user_id=1# int | Filter events by user ID (optional)try:api_client.events_api.list(action=action,filename=filename,_from=_from,job_id=job_id,org_id=org_id,project_id=project_id,query_id=query_id,task_id=task_id,to=to,user_id=user_id,)exceptexceptions.ApiExceptionase:print("Exception when calling EventsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
action
str
Used to start downloading process after annotation file had been created
[optional] if omitted the server will use the default value of “download”
filename
str
Desired output file name
[optional]
_from
datetime
UTC start date for events filtration. Default is the minimal time.
[optional]
job_id
int
Filter events by job ID
[optional]
org_id
int
Filter events by organization ID
[optional]
project_id
int
Filter events by project ID
[optional]
query_id
str
ID of query request that need to check or download
[optional]
task_id
int
Filter events by task ID
[optional]
to
datetime
UTC end date for events filtration. Default is the current time.
[optional]
user_id
int
Filter events by user ID
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['id', 'user_id']. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['id'] (optional)try:(data,response)=api_client.growth_api.list(filter=filter,page=page,page_size=page_size,sort=sort,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling GrowthApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘id’, ‘user_id’].
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘id’]
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedUserGrowthDataList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id="id_example"# str | patched_user_growth_data_request=PatchedUserGrowthDataRequest(github_prompt_shown=True,github_prompt_support_clicked=True,promotion_notifications_allowed=True,)# PatchedUserGrowthDataRequest | (optional)try:(data,response)=api_client.growth_api.partial_update(id,patched_user_growth_data_request=patched_user_growth_data_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling GrowthApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[UserGrowthData, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id="id_example"# str | try:(data,response)=api_client.growth_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling GrowthApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
str
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[UserGrowthData, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The new guide will be bound either to a project or a task, depending on parameters.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:annotation_guide_write_request=AnnotationGuideWriteRequest(task_id=1,project_id=1,markdown="markdown_example",)# AnnotationGuideWriteRequest | (optional)try:(data,response)=api_client.guides_api.create(annotation_guide_write_request=annotation_guide_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling GuidesApi.create(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AnnotationGuideRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
This also deletes all assets attached to the guide.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this annotation guide.try:api_client.guides_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling GuidesApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this annotation guide.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this annotation guide.patched_annotation_guide_write_request=PatchedAnnotationGuideWriteRequest(task_id=1,project_id=1,markdown="markdown_example",)# PatchedAnnotationGuideWriteRequest | (optional)try:(data,response)=api_client.guides_api.partial_update(id,patched_annotation_guide_write_request=patched_annotation_guide_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling GuidesApi.partial_update(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this annotation guide.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AnnotationGuideRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this annotation guide.try:(data,response)=api_client.guides_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling GuidesApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this annotation guide.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AnnotationGuideRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:key="key_example"# str | A unique value identifying this invitation.try:(data,response)=api_client.invitations_api.accept(key,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling InvitationsApi.accept(): %s\n"%e)
Parameters
Name
Type
Description
Notes
key
str
A unique value identifying this invitation.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[AcceptInvitationRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:invitation_write_request=InvitationWriteRequest(role=RoleEnum("worker"),email="email_example",)# InvitationWriteRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.invitations_api.create(invitation_write_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling InvitationsApi.create(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[InvitationRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:key="key_example"# str | A unique value identifying this invitation.try:api_client.invitations_api.decline(key,)exceptexceptions.ApiExceptionase:print("Exception when calling InvitationsApi.decline(): %s\n"%e)
Parameters
Name
Type
Description
Notes
key
str
A unique value identifying this invitation.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:key="key_example"# str | A unique value identifying this invitation.try:api_client.invitations_api.destroy(key,)exceptexceptions.ApiExceptionase:print("Exception when calling InvitationsApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
key
str
A unique value identifying this invitation.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)accepted=True# bool | A simple equality filter for the accepted field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['accepted', 'id', 'owner', 'user_id']. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)owner="owner_example"# str | A simple equality filter for the owner field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)search="search_example"# str | A search term. Available search_fields: ['owner'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['accepted', 'created_date', 'owner', 'user_id'] (optional)user_id=1# int | A simple equality filter for the user_id field (optional)try:(data,response)=api_client.invitations_api.list(x_organization=x_organization,accepted=accepted,filter=filter,org=org,org_id=org_id,owner=owner,page=page,page_size=page_size,search=search,sort=sort,user_id=user_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling InvitationsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
accepted
bool
A simple equality filter for the accepted field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘accepted’, ‘id’, ‘owner’, ‘user_id’].
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
owner
str
A simple equality filter for the owner field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
search
str
A search term. Available search_fields: [‘owner’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘accepted’, ‘created_date’, ‘owner’, ‘user_id’]
[optional]
user_id
int
A simple equality filter for the user_id field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedInvitationReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:key="key_example"# str | A unique value identifying this invitation.try:api_client.invitations_api.resend(key,)exceptexceptions.ApiExceptionase:print("Exception when calling InvitationsApi.resend(): %s\n"%e)
Parameters
Name
Type
Description
Notes
key
str
A unique value identifying this invitation.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:key="key_example"# str | A unique value identifying this invitation.try:(data,response)=api_client.invitations_api.retrieve(key,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling InvitationsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
key
str
A unique value identifying this invitation.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[InvitationRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:issue_write_request=IssueWriteRequest(frame=0,position=[3.14,],job=1,assignee=1,message="message_example",resolved=True,)# IssueWriteRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.issues_api.create(issue_write_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling IssuesApi.create(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[IssueRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this issue.try:api_client.issues_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling IssuesApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this issue.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)assignee="assignee_example"# str | A simple equality filter for the assignee field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['assignee', 'frame_id', 'id', 'job_id', 'owner', 'resolved', 'task_id']. (optional)frame_id=1# int | A simple equality filter for the frame_id field (optional)job_id=1# int | A simple equality filter for the job_id field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)owner="owner_example"# str | A simple equality filter for the owner field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)resolved=True# bool | A simple equality filter for the resolved field (optional)search="search_example"# str | A search term. Available search_fields: ['assignee', 'owner'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['assignee', 'frame_id', 'id', 'job_id', 'owner', 'resolved', 'task_id'] (optional)task_id=1# int | A simple equality filter for the task_id field (optional)try:(data,response)=api_client.issues_api.list(x_organization=x_organization,assignee=assignee,filter=filter,frame_id=frame_id,job_id=job_id,org=org,org_id=org_id,owner=owner,page=page,page_size=page_size,resolved=resolved,search=search,sort=sort,task_id=task_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling IssuesApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
assignee
str
A simple equality filter for the assignee field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘assignee’, ‘frame_id’, ‘id’, ‘job_id’, ‘owner’, ‘resolved’, ’task_id’].
[optional]
frame_id
int
A simple equality filter for the frame_id field
[optional]
job_id
int
A simple equality filter for the job_id field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
owner
str
A simple equality filter for the owner field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
resolved
bool
A simple equality filter for the resolved field
[optional]
search
str
A search term. Available search_fields: [‘assignee’, ‘owner’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘assignee’, ‘frame_id’, ‘id’, ‘job_id’, ‘owner’, ‘resolved’, ’task_id’]
[optional]
task_id
int
A simple equality filter for the task_id field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedIssueReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this issue.patched_issue_write_request=PatchedIssueWriteRequest(position=[3.14,],assignee=1,resolved=True,)# PatchedIssueWriteRequest | (optional)try:(data,response)=api_client.issues_api.partial_update(id,patched_issue_write_request=patched_issue_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling IssuesApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[IssueRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this issue.try:(data,response)=api_client.issues_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling IssuesApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this issue.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[IssueRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:job_write_request=JobWriteRequest(assignee=1,stage=JobStage("annotation"),state=OperationStatus("new"),type=JobType("annotation"),task_id=1,frame_selection_method=FrameSelectionMethod("random_uniform"),frame_count=1,frame_share=3.14,frames_per_job_count=1,frames_per_job_share=3.14,random_seed=0,frames=[0,],)# JobWriteRequest | try:(data,response)=api_client.jobs_api.create(job_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.create(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[JobRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The request POST /api/jobs/id/annotations initiates a background process to import annotations into a job. Please, use the GET /api/requests/<rq_id> endpoint for checking status of the process. The rq_id parameter can be found in the response on initiating request.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Annotation file name (optional)format="format_example"# str | Input format name You can get the list of supported formats at: /server/annotation/formats (optional)import_mode="replace"# str | How to import annotations (optional) if omitted the server will use the default value of "replace"location="cloud_storage"# str | where to import the annotation from (optional)use_default_location=True# bool | Use the location that was configured in the task to import annotation (optional) if omitted the server will use the default value of Trueannotation_file_request=AnnotationFileRequest(annotation_file=open('/path/to/file','rb'),)# AnnotationFileRequest | (optional)try:api_client.jobs_api.create_annotations(id,cloud_storage_id=cloud_storage_id,filename=filename,format=format,import_mode=import_mode,location=location,use_default_location=use_default_location,annotation_file_request=annotation_file_request,)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.create_annotations(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
cloud_storage_id
int
Storage id
[optional]
filename
str
Annotation file name
[optional]
format
str
Input format name You can get the list of supported formats at: /server/annotation/formats
[optional]
import_mode
str
How to import annotations
[optional] if omitted the server will use the default value of “replace”
location
str
where to import the annotation from
[optional]
use_default_location
bool
Use the location that was configured in the task to import annotation
[optional] if omitted the server will use the default value of True
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
create_dataset_export(
format,
id,
cloud_storage_id=None,
filename=None,
location=None,
save_images=None,
**kwargs
)
Initialize process to export resource as a dataset in a specific format
The request POST /api/<projects|tasks|jobs>/id/dataset/export will initialize a background process to export a dataset. To check status of the process please, use GET /api/requests/<rq_id> where rq_id is request ID returned in the response for this endpoint.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:format="format_example"# str | Desired output format name You can get the list of supported formats at: /server/annotation/formatsid=1# int | A unique integer value identifying this job.cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Desired output file name (optional)location="cloud_storage"# str | Where need to save downloaded dataset (optional)save_images=False# bool | Include images or not (optional) if omitted the server will use the default value of Falsetry:(data,response)=api_client.jobs_api.create_dataset_export(format,id,cloud_storage_id=cloud_storage_id,filename=filename,location=location,save_images=save_images,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.create_dataset_export(): %s\n"%e)
Parameters
Name
Type
Description
Notes
format
str
Desired output format name You can get the list of supported formats at: /server/annotation/formats
id
int
A unique integer value identifying this job.
cloud_storage_id
int
Storage id
[optional]
filename
str
Desired output file name
[optional]
location
str
Where need to save downloaded dataset
[optional]
save_images
bool
Include images or not
[optional] if omitted the server will use the default value of False
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Related annotations will be deleted as well. Please note, that not every job can be removed. Currently, it is only available for Ground Truth jobs.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.try:api_client.jobs_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.try:api_client.jobs_api.destroy_annotations(id,)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.destroy_annotations(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)assignee="assignee_example"# str | A simple equality filter for the assignee field (optional)dimension="1d"# str | A simple equality filter for the dimension field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['assignee', 'dimension', 'id', 'media_type', 'mode', 'parent_job_id', 'project_id', 'project_name', 'stage', 'state', 'task_id', 'task_name', 'type', 'updated_date']. (optional)media_type="image"# str | A simple equality filter for the media_type field (optional)mode="annotation"# str | A simple equality filter for the mode field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)parent_job_id=1# int | A simple equality filter for the parent_job_id field (optional)project_id=1# int | A simple equality filter for the project_id field (optional)project_name="project_name_example"# str | A simple equality filter for the project_name field (optional)search="search_example"# str | A search term. Available search_fields: ['assignee', 'project_name', 'task_name'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['assignee', 'dimension', 'id', 'media_type', 'mode', 'parent_job_id', 'project_id', 'project_name', 'stage', 'state', 'task_id', 'task_name', 'type', 'updated_date'] (optional)stage="annotation"# str | A simple equality filter for the stage field (optional)state="new"# str | A simple equality filter for the state field (optional)task_id=1# int | A simple equality filter for the task_id field (optional)task_name="task_name_example"# str | A simple equality filter for the task_name field (optional)type="annotation"# str | A simple equality filter for the type field (optional)try:(data,response)=api_client.jobs_api.list(x_organization=x_organization,assignee=assignee,dimension=dimension,filter=filter,media_type=media_type,mode=mode,org=org,org_id=org_id,page=page,page_size=page_size,parent_job_id=parent_job_id,project_id=project_id,project_name=project_name,search=search,sort=sort,stage=stage,state=state,task_id=task_id,task_name=task_name,type=type,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
assignee
str
A simple equality filter for the assignee field
[optional]
dimension
str
A simple equality filter for the dimension field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘assignee’, ‘dimension’, ‘id’, ‘media_type’, ‘mode’, ‘parent_job_id’, ‘project_id’, ‘project_name’, ‘stage’, ‘state’, ’task_id’, ’task_name’, ’type’, ‘updated_date’].
[optional]
media_type
str
A simple equality filter for the media_type field
[optional]
mode
str
A simple equality filter for the mode field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
parent_job_id
int
A simple equality filter for the parent_job_id field
[optional]
project_id
int
A simple equality filter for the project_id field
[optional]
project_name
str
A simple equality filter for the project_name field
[optional]
search
str
A search term. Available search_fields: [‘assignee’, ‘project_name’, ’task_name’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘assignee’, ‘dimension’, ‘id’, ‘media_type’, ‘mode’, ‘parent_job_id’, ‘project_id’, ‘project_name’, ‘stage’, ‘state’, ’task_id’, ’task_name’, ’type’, ‘updated_date’]
[optional]
stage
str
A simple equality filter for the stage field
[optional]
state
str
A simple equality filter for the state field
[optional]
task_id
int
A simple equality filter for the task_id field
[optional]
task_name
str
A simple equality filter for the task_name field
[optional]
type
str
A simple equality filter for the type field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedJobReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.patched_job_write_request=PatchedJobWriteRequest(assignee=1,stage=JobStage("annotation"),state=OperationStatus("new"),)# PatchedJobWriteRequest | (optional)try:(data,response)=api_client.jobs_api.partial_update(id,patched_job_write_request=patched_job_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[JobRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:action="create"# str | id=1# int | A unique integer value identifying this job.patched_labeled_data_request=PatchedLabeledDataRequest(version=0,tags=[LabeledImageRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],),],shapes=[LabeledShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,elements=[SubLabeledShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,),],),],tracks=[LabeledTrackRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],shapes=[TrackedShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],attributes=[AttributeValRequest(spec_id=1,value="value_example",),],id=1,frame=0,),],elements=[SubLabeledTrackRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],shapes=[TrackedShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],attributes=[AttributeValRequest(spec_id=1,value="value_example",),],id=1,frame=0,),],),],),],intervals=[LabeledIntervalRequest(id=1,label_id=0,group=0,source="manual",attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,start=0,stop=0,),],)# PatchedLabeledDataRequest | (optional)try:api_client.jobs_api.partial_update_annotations(action,id,patched_labeled_data_request=patched_labeled_data_request,)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.partial_update_annotations(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.patched_job_data_meta_write_request=PatchedJobDataMetaWriteRequest(deleted_frames=[0,],)# PatchedJobDataMetaWriteRequest | (optional)try:(data,response)=api_client.jobs_api.partial_update_data_meta(id,patched_job_data_meta_write_request=patched_job_data_meta_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.partial_update_data_meta(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[DataMetaRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
WARNING: this operation is not protected from race conditions. It’s up to the user to ensure no parallel calls to this operation happen. It affects image access, including exports with images, backups, chunk downloading etc.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.patched_job_validation_layout_write_request=PatchedJobValidationLayoutWriteRequest(frame_selection_method=None,honeypot_real_frames=[0,],)# PatchedJobValidationLayoutWriteRequest | (optional)try:(data,response)=api_client.jobs_api.partial_update_validation_layout(id,patched_job_validation_layout_write_request=patched_job_validation_layout_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.partial_update_validation_layout(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[JobValidationLayoutRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.try:(data,response)=api_client.jobs_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[JobRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Deprecation warning: Utilizing this endpoint to export job dataset in a specific format is no longer possible. Consider using new API: - POST /api/jobs/<job_id>/dataset/export?save_images=True to initiate export process - GET /api/requests/<rq_id> to check process status, where rq_id is request id returned on initializing request - GET result_url to download a prepared file, where result_url can be found in the response on checking status request
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.action="action_example"# str | This parameter is no longer supported (optional)cloud_storage_id=1# int | This parameter is no longer supported (optional)filename="filename_example"# str | This parameter is no longer supported (optional)format="format_example"# str | This parameter is no longer supported (optional)location="cloud_storage"# str | This parameter is no longer supported (optional)try:(data,response)=api_client.jobs_api.retrieve_annotations(id,action=action,cloud_storage_id=cloud_storage_id,filename=filename,format=format,location=location,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.retrieve_annotations(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
action
str
This parameter is no longer supported
[optional]
cloud_storage_id
int
This parameter is no longer supported
[optional]
filename
str
This parameter is no longer supported
[optional]
format
str
This parameter is no longer supported
[optional]
location
str
This parameter is no longer supported
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[LabeledData, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.type="chunk"# str | Specifies the type of the requested dataindex=1# int | A unique number value identifying chunk, starts from 0 for each job (optional)number=1# int | A unique number value identifying chunk or frame. The numbers are the same as for the task. Deprecated for chunks in favor of 'index' (optional)quality="compressed"# str | Specifies the quality level of the requested data (optional)try:(data,response)=api_client.jobs_api.retrieve_data(id,type,index=index,number=number,quality=quality,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.retrieve_data(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
type
str
Specifies the type of the requested data
index
int
A unique number value identifying chunk, starts from 0 for each job
[optional]
number
int
A unique number value identifying chunk or frame. The numbers are the same as for the task. Deprecated for chunks in favor of ‘index’
[optional]
quality
str
Specifies the quality level of the requested data
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[file_type, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
* X-Checksum - Data checksum, applicable for chunks only * X-Chunk-Size - Decoded chunk size in bytes, applicable for chunks only * X-Updated-Date - Data update date, applicable for chunks only
206
Partial chunk data
* X-Checksum - Data checksum, applicable for chunks only * X-Chunk-Size - Decoded chunk size in bytes, applicable for chunks only * X-Updated-Date - Data update date, applicable for chunks only
416
Requested range is not satisfiable
* X-Chunk-Size - Decoded chunk size in bytes, applicable for chunks only
retrieve_data_meta
retrieve_data_meta(
id,
**kwargs
)
Get metainformation for media files in a job
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.try:(data,response)=api_client.jobs_api.retrieve_data_meta(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.retrieve_data_meta(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[DataMetaRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.prefer="Prefer_example"# str | RFC 7240 preference token. Send `handling=empty` to receive a 204 No Content response when no media-derived preview exists. Without the preference, the server returns a default placeholder image with status 200. (optional)try:api_client.jobs_api.retrieve_preview(id,prefer=prefer,)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.retrieve_preview(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
prefer
str
RFC 7240 preference token. Send handling=empty to receive a 204 No Content response when no media-derived preview exists. Without the preference, the server returns a default placeholder image with status 200.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
No media-derived preview is available. The client should render a placeholder image. Only returned when the request opts in via `Prefer: handling=empty`.
-
retrieve_validation_layout
retrieve_validation_layout(
id,
**kwargs
)
Allows getting current validation configuration
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.try:(data,response)=api_client.jobs_api.retrieve_validation_layout(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.retrieve_validation_layout(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this job.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[JobValidationLayoutRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this job.labeled_data_request=LabeledDataRequest(version=0,tags=[LabeledImageRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],),],shapes=[LabeledShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,elements=[SubLabeledShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,),],),],tracks=[LabeledTrackRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],shapes=[TrackedShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],attributes=[AttributeValRequest(spec_id=1,value="value_example",),],id=1,frame=0,),],elements=[SubLabeledTrackRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],shapes=[TrackedShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],attributes=[AttributeValRequest(spec_id=1,value="value_example",),],id=1,frame=0,),],),],),],intervals=[LabeledIntervalRequest(id=1,label_id=0,group=0,source="manual",attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,start=0,stop=0,),],)# LabeledDataRequest | (optional)try:api_client.jobs_api.update_annotations(id,labeled_data_request=labeled_data_request,)exceptexceptions.ApiExceptionase:print("Exception when calling JobsApi.update_annotations(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
To delete a sublabel, please use the PATCH method of the parent label.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this label.try:api_client.labels_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling LabelsApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this label.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)color="color_example"# str | A simple equality filter for the color field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['color', 'id', 'name', 'parent', 'parent_id', 'type']. (optional)job_id=1# int | A simple equality filter for job id (optional)name="name_example"# str | A simple equality filter for the name field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)parent="parent_example"# str | A simple equality filter for the parent field (optional)parent_id=1# int | A simple equality filter for the parent_id field (optional)project_id=1# int | A simple equality filter for project id (optional)search="search_example"# str | A search term. Available search_fields: ['name', 'parent'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['color', 'id', 'name', 'parent', 'parent_id', 'type'] (optional)task_id=1# int | A simple equality filter for task id (optional)type="any"# str | A simple equality filter for the type field (optional)try:(data,response)=api_client.labels_api.list(x_organization=x_organization,color=color,filter=filter,job_id=job_id,name=name,org=org,org_id=org_id,page=page,page_size=page_size,parent=parent,parent_id=parent_id,project_id=project_id,search=search,sort=sort,task_id=task_id,type=type,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling LabelsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
color
str
A simple equality filter for the color field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘color’, ‘id’, ’name’, ‘parent’, ‘parent_id’, ’type’].
[optional]
job_id
int
A simple equality filter for job id
[optional]
name
str
A simple equality filter for the name field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
parent
str
A simple equality filter for the parent field
[optional]
parent_id
int
A simple equality filter for the parent_id field
[optional]
project_id
int
A simple equality filter for project id
[optional]
search
str
A search term. Available search_fields: [’name’, ‘parent’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘color’, ‘id’, ’name’, ‘parent’, ‘parent_id’, ’type’]
[optional]
task_id
int
A simple equality filter for task id
[optional]
type
str
A simple equality filter for the type field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedLabelList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
To modify a sublabel, please use the PATCH method of the parent label.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this label.patched_label_request=PatchedLabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],deleted=True,type=None,svg="svg_example",sublabels=[SublabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],type=None,has_parent=True,),],)# PatchedLabelRequest | (optional)try:(data,response)=api_client.labels_api.partial_update(id,patched_label_request=patched_label_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling LabelsApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[Label, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this label.try:(data,response)=api_client.labels_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling LabelsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this label.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[Label, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Allows to execute a function for immediate computation. Intended for short-lived executions, useful for interactive calls. When executed for interactive annotation, the job id must be specified in the ‘job’ input field. The task id is not required in this case, but if it is specified, it must match the job task id.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:func_id="g6bUUGjjNSwg0_bs9ZayIMrKdgNvb"# str | online_function_call_request=OnlineFunctionCallRequest(job=1,task=1,)# OnlineFunctionCallRequest | (optional)try:api_client.lambda_api.create_functions(func_id,online_function_call_request=online_function_call_request,)exceptexceptions.ApiExceptionase:print("Exception when calling LambdaApi.create_functions(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:function_call_request=FunctionCallRequest(function="function_example",task=1,job=1,max_distance=1,threshold=3.14,cleanup=False,conv_mask_to_poly=True,conv_mask_to_poly=True,mapping={"key":LabelMappingEntryRequest(name="name_example",attributes={"key":"key_example",},sublabels={"key":SublabelMappingEntryRequest(name="name_example",attributes={"key":"key_example",},),},),},roi=[1,],)# FunctionCallRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.lambda_api.create_requests(function_call_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling LambdaApi.create_requests(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[FunctionCall, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id="id_example"# str | Request idtry:api_client.lambda_api.delete_requests(id,)exceptexceptions.ApiExceptionase:print("Exception when calling LambdaApi.delete_requests(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
str
Request id
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:try:api_client.lambda_api.list_functions()exceptexceptions.ApiExceptionase:print("Exception when calling LambdaApi.list_functions(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:try:(data,response)=api_client.lambda_api.list_requests()pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling LambdaApi.list_requests(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[list[FunctionCall], urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:func_id="g6bUUGjjNSwg0_bs9ZayIMrKdgNvb"# str | try:(data,response)=api_client.lambda_api.retrieve_functions(func_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling LambdaApi.retrieve_functions(): %s\n"%e)
Parameters
Name
Type
Description
Notes
func_id
str
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[dict[str, typing.Union[typing.Any, none_type]], urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id="id_example"# str | Request idtry:(data,response)=api_client.lambda_api.retrieve_requests(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling LambdaApi.retrieve_requests(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
str
Request id
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[FunctionCall, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this membership.try:api_client.memberships_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling MembershipsApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this membership.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['id', 'role', 'user']. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)role="worker"# str | A simple equality filter for the role field (optional)search="search_example"# str | A search term. Available search_fields: ['user'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['id', 'role', 'user'] (optional)user="user_example"# str | A simple equality filter for the user field (optional)try:(data,response)=api_client.memberships_api.list(x_organization=x_organization,filter=filter,org=org,org_id=org_id,page=page,page_size=page_size,role=role,search=search,sort=sort,user=user,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling MembershipsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘id’, ‘role’, ‘user’].
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
role
str
A simple equality filter for the role field
[optional]
search
str
A search term. Available search_fields: [‘user’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘id’, ‘role’, ‘user’]
[optional]
user
str
A simple equality filter for the user field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedMembershipReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this membership.patched_membership_write_request=PatchedMembershipWriteRequest(role=RoleEnum("worker"),)# PatchedMembershipWriteRequest | (optional)try:(data,response)=api_client.memberships_api.partial_update(id,patched_membership_write_request=patched_membership_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling MembershipsApi.partial_update(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this membership.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[MembershipRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this membership.try:(data,response)=api_client.memberships_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling MembershipsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this membership.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[MembershipRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:organization_write_request=OrganizationWriteRequest(slug="z",name="name_example",description="description_example",contact=None,)# OrganizationWriteRequest | try:(data,response)=api_client.organizations_api.create(organization_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling OrganizationsApi.create(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[OrganizationRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this organization.try:api_client.organizations_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling OrganizationsApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this organization.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['id', 'name', 'owner', 'slug']. (optional)name="name_example"# str | A simple equality filter for the name field (optional)owner="owner_example"# str | A simple equality filter for the owner field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)search="search_example"# str | A search term. Available search_fields: ['name', 'owner', 'slug'] (optional)slug="slug_example"# str | A simple equality filter for the slug field (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['id', 'name', 'owner', 'slug'] (optional)try:(data,response)=api_client.organizations_api.list(filter=filter,name=name,owner=owner,page=page,page_size=page_size,search=search,slug=slug,sort=sort,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling OrganizationsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘id’, ’name’, ‘owner’, ‘slug’].
[optional]
name
str
A simple equality filter for the name field
[optional]
owner
str
A simple equality filter for the owner field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
search
str
A search term. Available search_fields: [’name’, ‘owner’, ‘slug’]
[optional]
slug
str
A simple equality filter for the slug field
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘id’, ’name’, ‘owner’, ‘slug’]
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedOrganizationReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this organization.patched_organization_write_request=PatchedOrganizationWriteRequest(slug="z",name="name_example",description="description_example",contact=None,)# PatchedOrganizationWriteRequest | (optional)try:(data,response)=api_client.organizations_api.partial_update(id,patched_organization_write_request=patched_organization_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling OrganizationsApi.partial_update(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this organization.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[OrganizationRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this organization.try:(data,response)=api_client.organizations_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling OrganizationsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this organization.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[OrganizationRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:project_write_request=ProjectWriteRequest(name="name_example",labels=[PatchedLabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],deleted=True,type=None,svg="svg_example",sublabels=[SublabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],type=None,has_parent=True,),],),],owner_id=1,assignee_id=1,bug_tracker="bug_tracker_example",target_storage=PatchedProjectWriteRequestTargetStorage(None),source_storage=PatchedProjectWriteRequestTargetStorage(None),)# ProjectWriteRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.projects_api.create(project_write_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.create(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[ProjectRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The backup import process is as follows: The first request POST /api/projects/backup schedules a background job on the server in which the process of creating a project from the uploaded backup is carried out. To check the status of the import process, use GET /api/requests/rq_id, where rq_id is the request ID obtained from the response to the previous request. Once the import completes successfully, the response will contain the ID of the newly created project in the result_id field.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Backup file name (optional)location="local"# str | Where to import the backup file from (optional) if omitted the server will use the default value of "local"org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)project_file_request=ProjectFileRequest(project_file=open('/path/to/file','rb'),)# ProjectFileRequest | (optional)try:(data,response)=api_client.projects_api.create_backup(x_organization=x_organization,cloud_storage_id=cloud_storage_id,filename=filename,location=location,org=org,org_id=org_id,project_file_request=project_file_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.create_backup(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
cloud_storage_id
int
Storage id
[optional]
filename
str
Backup file name
[optional]
location
str
Where to import the backup file from
[optional] if omitted the server will use the default value of “local”
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The request POST /api/<projects|tasks>/id/backup/export will initialize a background process to backup a resource. To check status of the process please, use GET /api/requests/<rq_id> where rq_id is request ID returned in the response for this endpoint.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this project.cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Backup file name (optional)lightweight=True# bool | Makes a lightweight backup (without media files) for tasks whose media is located in cloud storage (optional) if omitted the server will use the default value of Truelocation="cloud_storage"# str | Where need to save downloaded backup (optional)try:(data,response)=api_client.projects_api.create_backup_export(id,cloud_storage_id=cloud_storage_id,filename=filename,lightweight=lightweight,location=location,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.create_backup_export(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this project.
cloud_storage_id
int
Storage id
[optional]
filename
str
Backup file name
[optional]
lightweight
bool
Makes a lightweight backup (without media files) for tasks whose media is located in cloud storage
[optional] if omitted the server will use the default value of True
location
str
Where need to save downloaded backup
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The request POST /api/projects/id/dataset initiates a background process to import dataset into a project. Please, use the GET /api/requests/<rq_id> endpoint for checking status of the process. The rq_id parameter can be found in the response on initiating request.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this project.cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Dataset file name (optional)format="format_example"# str | Desired dataset format name You can get the list of supported formats at: /server/annotation/formats (optional)location="cloud_storage"# str | Where to import the dataset from (optional)dataset_file_request=DatasetFileRequest(dataset_file=open('/path/to/file','rb'),)# DatasetFileRequest | (optional)try:(data,response)=api_client.projects_api.create_dataset(id,cloud_storage_id=cloud_storage_id,filename=filename,format=format,location=location,dataset_file_request=dataset_file_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.create_dataset(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this project.
cloud_storage_id
int
Storage id
[optional]
filename
str
Dataset file name
[optional]
format
str
Desired dataset format name You can get the list of supported formats at: /server/annotation/formats
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
create_dataset_export(
format,
id,
cloud_storage_id=None,
filename=None,
location=None,
save_images=None,
**kwargs
)
Initialize process to export resource as a dataset in a specific format
The request POST /api/<projects|tasks|jobs>/id/dataset/export will initialize a background process to export a dataset. To check status of the process please, use GET /api/requests/<rq_id> where rq_id is request ID returned in the response for this endpoint.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:format="format_example"# str | Desired output format name You can get the list of supported formats at: /server/annotation/formatsid=1# int | A unique integer value identifying this project.cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Desired output file name (optional)location="cloud_storage"# str | Where need to save downloaded dataset (optional)save_images=False# bool | Include images or not (optional) if omitted the server will use the default value of Falsetry:(data,response)=api_client.projects_api.create_dataset_export(format,id,cloud_storage_id=cloud_storage_id,filename=filename,location=location,save_images=save_images,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.create_dataset_export(): %s\n"%e)
Parameters
Name
Type
Description
Notes
format
str
Desired output format name You can get the list of supported formats at: /server/annotation/formats
id
int
A unique integer value identifying this project.
cloud_storage_id
int
Storage id
[optional]
filename
str
Desired output file name
[optional]
location
str
Where need to save downloaded dataset
[optional]
save_images
bool
Include images or not
[optional] if omitted the server will use the default value of False
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this project.try:api_client.projects_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this project.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)assignee="assignee_example"# str | A simple equality filter for the assignee field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['assignee', 'id', 'name', 'owner', 'status', 'updated_date']. (optional)name="name_example"# str | A simple equality filter for the name field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)owner="owner_example"# str | A simple equality filter for the owner field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)search="search_example"# str | A search term. Available search_fields: ['assignee', 'name', 'owner'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['assignee', 'id', 'name', 'owner', 'status', 'updated_date'] (optional)status="annotation"# str | A simple equality filter for the status field (optional)try:(data,response)=api_client.projects_api.list(x_organization=x_organization,assignee=assignee,filter=filter,name=name,org=org,org_id=org_id,owner=owner,page=page,page_size=page_size,search=search,sort=sort,status=status,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
assignee
str
A simple equality filter for the assignee field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘assignee’, ‘id’, ’name’, ‘owner’, ‘status’, ‘updated_date’].
[optional]
name
str
A simple equality filter for the name field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
owner
str
A simple equality filter for the owner field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
search
str
A search term. Available search_fields: [‘assignee’, ’name’, ‘owner’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘assignee’, ‘id’, ’name’, ‘owner’, ‘status’, ‘updated_date’]
[optional]
status
str
A simple equality filter for the status field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedProjectReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this project.patched_project_write_request=PatchedProjectWriteRequest(name="name_example",labels=[PatchedLabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],deleted=True,type=None,svg="svg_example",sublabels=[SublabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],type=None,has_parent=True,),],),],owner_id=1,assignee_id=1,bug_tracker="bug_tracker_example",target_storage=PatchedProjectWriteRequestTargetStorage(None),source_storage=PatchedProjectWriteRequestTargetStorage(None),organization_id=1,)# PatchedProjectWriteRequest | (optional)try:(data,response)=api_client.projects_api.partial_update(id,patched_project_write_request=patched_project_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[ProjectRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this project.try:(data,response)=api_client.projects_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this project.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[ProjectRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this project.prefer="Prefer_example"# str | RFC 7240 preference token. Send `handling=empty` to receive a 204 No Content response when no media-derived preview exists. Without the preference, the server returns a default placeholder image with status 200. (optional)try:api_client.projects_api.retrieve_preview(id,prefer=prefer,)exceptexceptions.ApiExceptionase:print("Exception when calling ProjectsApi.retrieve_preview(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this project.
prefer
str
RFC 7240 preference token. Send handling=empty to receive a 204 No Content response when no media-derived preview exists. Without the preference, the server returns a default placeholder image with status 200.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
No media-derived preview is available. The client should render a placeholder image. Only returned when the request opts in via `Prefer: handling=empty`.
Deprecation warning: Utilizing this endpoint to check the computation status is no longer possible. Consider using common requests API: GET /api/requests/<rq_id>
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:rq_id="rq_id_example"# str | The report creation request id. Can be specified to check the report creation status. (optional)quality_report_create_request=QualityReportCreateRequest(task_id=1,project_id=1,)# QualityReportCreateRequest | (optional)try:(data,response)=api_client.quality_api.create_report(rq_id=rq_id,quality_report_create_request=quality_report_create_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.create_report(): %s\n"%e)
Parameters
Name
Type
Description
Notes
rq_id
str
The report creation request id. Can be specified to check the report creation status.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualityReport, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
A quality report request has been enqueued, the request id is returned. The request status can be checked at this endpoint by passing the rq_id as the query parameter. If the request id is specified, this response means the quality report request is queued or is being processed.
-
400
Invalid or failed request, check the response data for details
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:quality_requirement_request=QualityRequirementRequest(settings_id=1,name="name_example",sort_order=-2147483648,filter="filter_example",enabled=True,annotation_type=PatchedQualityRequirementRequestAnnotationType(None),metric=PatchedQualityRequirementRequestMetric(None),required_score=0,parent_requirement=1,iou_threshold=0,point_size=0,point_size_base=PatchedQualityRequirementRequestPointSizeBase(None),line_thickness=0,match_orientation=True,line_orientation_threshold=0,match_groups=True,group_match_threshold=0,check_covered_annotations=True,object_visibility_threshold=0,panoptic_comparison=True,attribute_comparison=PatchedQualityRequirementRequestAttributeComparison(None),)# QualityRequirementRequest | (optional)try:(data,response)=api_client.quality_api.create_settings_requirements(quality_requirement_request=quality_requirement_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.create_settings_requirements(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualityRequirement, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:quality_requirement_bulk_create_request=QualityRequirementBulkCreateRequest(settings_id=1,requirements=[QualityRequirementBulkCreateNodeRequest(name="name_example",sort_order=-2147483648,filter="filter_example",enabled=True,annotation_type=PatchedQualityRequirementRequestAnnotationType(None),metric=PatchedQualityRequirementRequestMetric(None),required_score=0,parent_requirement=1,iou_threshold=0,point_size=0,point_size_base=PatchedQualityRequirementRequestPointSizeBase(None),line_thickness=0,match_orientation=True,line_orientation_threshold=0,match_groups=True,group_match_threshold=0,check_covered_annotations=True,object_visibility_threshold=0,panoptic_comparison=True,attribute_comparison=PatchedQualityRequirementRequestAttributeComparison(None),children=[QualityRequirementBulkCreateNodeRequest(),],),],)# QualityRequirementBulkCreateRequest | try:(data,response)=api_client.quality_api.create_settings_requirements_bulk(quality_requirement_bulk_create_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.create_settings_requirements_bulk(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[list[QualityRequirement], urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this quality requirement.try:api_client.quality_api.destroy_settings_requirements(id,)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.destroy_settings_requirements(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this quality requirement.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['frame', 'id', 'job_id', 'project_id', 'severity', 'task_id', 'type']. (optional)frame=1# int | A simple equality filter for the frame field (optional)job_id=1# int | A simple equality filter for the job_id field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)project_id=1# int | A simple equality filter for the project_id field (optional)report_id=1# int | A simple equality filter for report id (optional)severity="error"# str | A simple equality filter for the severity field (optional) if omitted the server will use the default value of "error"sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['frame', 'id', 'job_id', 'project_id', 'severity', 'task_id', 'type'] (optional)task_id=1# int | A simple equality filter for the task_id field (optional)type="missing_annotation"# str | A simple equality filter for the type field (optional)try:(data,response)=api_client.quality_api.list_conflicts(x_organization=x_organization,filter=filter,frame=frame,job_id=job_id,org=org,org_id=org_id,page=page,page_size=page_size,project_id=project_id,report_id=report_id,severity=severity,sort=sort,task_id=task_id,type=type,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.list_conflicts(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘frame’, ‘id’, ‘job_id’, ‘project_id’, ‘severity’, ’task_id’, ’type’].
[optional]
frame
int
A simple equality filter for the frame field
[optional]
job_id
int
A simple equality filter for the job_id field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
project_id
int
A simple equality filter for the project_id field
[optional]
report_id
int
A simple equality filter for report id
[optional]
severity
str
A simple equality filter for the severity field
[optional] if omitted the server will use the default value of “error”
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘frame’, ‘id’, ‘job_id’, ‘project_id’, ‘severity’, ’task_id’, ’type’]
[optional]
task_id
int
A simple equality filter for the task_id field
[optional]
type
str
A simple equality filter for the type field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedAnnotationConflictList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Method returns a paginated list of quality reports.
The "target" parameter is required when the "task_id" or "project_id" filter is used. The "parent_id" filter requires the "target" parameter. Valid parent report target to requested target combinations are: task to job, project to task, and project to job. Please note that a report can be reused in several parent reports, but the "parent_id" field in responses will include only the first parent report id. Filtering project report children with target "job" still returns all the relevant nested job reports, even though their response "parent_id" values refer to task reports.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['created_date', 'gt_last_updated', 'id', 'job_id', 'project_id', 'target_last_updated', 'task_id']. (optional)include_legacy=False# bool | Include reports stored in the legacy data format (optional) if omitted the server will use the default value of Falsejob_id=1# int | A simple equality filter for the job_id field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)parent_id=1# int | A parent report id filter. Requires a compatible target filter (optional)project_id=1# int | A simple equality filter for project id (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['created_date', 'gt_last_updated', 'id', 'job_id', 'project_id', 'target_last_updated', 'task_id'] (optional)target="job"# str | A simple equality filter for target (optional)task_id=1# int | A simple equality filter for task id (optional)try:(data,response)=api_client.quality_api.list_reports(x_organization=x_organization,filter=filter,include_legacy=include_legacy,job_id=job_id,org=org,org_id=org_id,page=page,page_size=page_size,parent_id=parent_id,project_id=project_id,sort=sort,target=target,task_id=task_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.list_reports(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘created_date’, ‘gt_last_updated’, ‘id’, ‘job_id’, ‘project_id’, ’target_last_updated’, ’task_id’].
[optional]
include_legacy
bool
Include reports stored in the legacy data format
[optional] if omitted the server will use the default value of False
job_id
int
A simple equality filter for the job_id field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
parent_id
int
A parent report id filter. Requires a compatible target filter
[optional]
project_id
int
A simple equality filter for project id
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘created_date’, ‘gt_last_updated’, ‘id’, ‘job_id’, ‘project_id’, ’target_last_updated’, ’task_id’]
[optional]
target
str
A simple equality filter for target
[optional]
task_id
int
A simple equality filter for task id
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedQualityReportList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Please note that child task settings are included by default if the "project_id" filter is used. If you want to restrict results only to a specific parent type, use the "parent_type" parameter.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['created_date', 'id', 'inherit', 'project_id', 'task_id', 'updated_date']. (optional)inherit=True# bool | A simple equality filter for the inherit field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)parent_type="project"# str | A simple equality filter for parent instance type (optional)project_id=1# int | A simple equality filter for project id (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['created_date', 'id', 'inherit', 'project_id', 'task_id', 'updated_date'] (optional)task_id=1# int | A simple equality filter for the task_id field (optional)try:(data,response)=api_client.quality_api.list_settings(x_organization=x_organization,filter=filter,inherit=inherit,org=org,org_id=org_id,page=page,page_size=page_size,parent_type=parent_type,project_id=project_id,sort=sort,task_id=task_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.list_settings(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘created_date’, ‘id’, ‘inherit’, ‘project_id’, ’task_id’, ‘updated_date’].
[optional]
inherit
bool
A simple equality filter for the inherit field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
parent_type
str
A simple equality filter for parent instance type
[optional]
project_id
int
A simple equality filter for project id
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘created_date’, ‘id’, ‘inherit’, ‘project_id’, ’task_id’, ‘updated_date’]
[optional]
task_id
int
A simple equality filter for the task_id field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedQualitySettingsList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)annotation_type="tag"# str | A simple equality filter for the annotation_type field (optional)enabled=True# bool | A simple equality filter for the enabled field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['annotation_type', 'created_date', 'enabled', 'id', 'project_id', 'settings_id', 'task_id', 'updated_date']. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)project_id=1# int | Project id filter (optional)settings_id=1# int | Settings id filter (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['annotation_type', 'created_date', 'enabled', 'id', 'name', 'project_id', 'settings_id', 'sort_order', 'task_id', 'updated_date'] (optional)task_id=1# int | Task id filter (optional)try:(data,response)=api_client.quality_api.list_settings_requirements(x_organization=x_organization,annotation_type=annotation_type,enabled=enabled,filter=filter,org=org,org_id=org_id,page=page,page_size=page_size,project_id=project_id,settings_id=settings_id,sort=sort,task_id=task_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.list_settings_requirements(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
annotation_type
str
A simple equality filter for the annotation_type field
[optional]
enabled
bool
A simple equality filter for the enabled field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘annotation_type’, ‘created_date’, ’enabled’, ‘id’, ‘project_id’, ‘settings_id’, ’task_id’, ‘updated_date’].
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
project_id
int
Project id filter
[optional]
settings_id
int
Settings id filter
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘annotation_type’, ‘created_date’, ’enabled’, ‘id’, ’name’, ‘project_id’, ‘settings_id’, ‘sort_order’, ’task_id’, ‘updated_date’]
[optional]
task_id
int
Task id filter
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedQualityRequirementListItemList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | An id of a quality settings instancepatched_quality_settings_request=PatchedQualitySettingsRequest(job_filter="job_filter_example",inherit=True,max_validations_per_job=0,requirements=[QualityRequirementListItemRequest(settings_id=1,name="name_example",sort_order=-2147483648,filter="filter_example",enabled=True,annotation_type=PatchedQualityRequirementRequestAnnotationType(None),metric=PatchedQualityRequirementRequestMetric(None),required_score=0,parent_requirement=1,iou_threshold=0,point_size=0,point_size_base=PatchedQualityRequirementRequestPointSizeBase(None),line_thickness=0,match_orientation=True,line_orientation_threshold=0,match_groups=True,group_match_threshold=0,check_covered_annotations=True,object_visibility_threshold=0,panoptic_comparison=True,attribute_comparison=PatchedQualityRequirementRequestAttributeComparison(None),),],)# PatchedQualitySettingsRequest | (optional)try:(data,response)=api_client.quality_api.partial_update_settings(id,patched_quality_settings_request=patched_quality_settings_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.partial_update_settings(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualitySettings, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this quality requirement.patched_quality_requirement_request=PatchedQualityRequirementRequest(settings_id=1,name="name_example",sort_order=-2147483648,filter="filter_example",enabled=True,annotation_type=PatchedQualityRequirementRequestAnnotationType(None),metric=PatchedQualityRequirementRequestMetric(None),required_score=0,parent_requirement=1,iou_threshold=0,point_size=0,point_size_base=PatchedQualityRequirementRequestPointSizeBase(None),line_thickness=0,match_orientation=True,line_orientation_threshold=0,match_groups=True,group_match_threshold=0,check_covered_annotations=True,object_visibility_threshold=0,panoptic_comparison=True,attribute_comparison=PatchedQualityRequirementRequestAttributeComparison(None),)# PatchedQualityRequirementRequest | (optional)try:(data,response)=api_client.quality_api.partial_update_settings_requirements(id,patched_quality_requirement_request=patched_quality_requirement_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.partial_update_settings_requirements(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this quality requirement.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualityRequirement, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this quality report.try:(data,response)=api_client.quality_api.retrieve_report(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.retrieve_report(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this quality report.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualityReport, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this quality report.try:(data,response)=api_client.quality_api.retrieve_report_confusion(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.retrieve_report_confusion(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this quality report.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[file_type, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
ZIP archive with per-requirement confusion matrices
-
retrieve_report_data
retrieve_report_data(
id,
format=None,
**kwargs
)
Get quality report contents
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this quality report.format="json"# str | (optional) if omitted the server will use the default value of "json"try:(data,response)=api_client.quality_api.retrieve_report_data(id,format=format,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.retrieve_report_data(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this quality report.
format
str
[optional] if omitted the server will use the default value of “json”
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[file_type, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this quality report.requirement=1# int | Quality requirement id in the reportformat="json"# str | (optional) if omitted the server will use the default value of "json"try:(data,response)=api_client.quality_api.retrieve_report_requirement_confusion(id,requirement,format=format,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.retrieve_report_requirement_confusion(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this quality report.
requirement
int
Quality requirement id in the report
format
str
[optional] if omitted the server will use the default value of “json”
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualityReportConfusionMatrix, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
JSON confusion matrix for the requested quality requirement
-
404
Requirement confusion matrix was not found
-
retrieve_settings
retrieve_settings(
id,
**kwargs
)
Get quality settings instance details
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | An id of a quality settings instancetry:(data,response)=api_client.quality_api.retrieve_settings(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.retrieve_settings(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
An id of a quality settings instance
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualitySettings, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this quality requirement.try:(data,response)=api_client.quality_api.retrieve_settings_requirements(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.retrieve_settings_requirements(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this quality requirement.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualityRequirement, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | An id of a quality settings instancequality_settings_request=QualitySettingsRequest(job_filter="job_filter_example",inherit=True,max_validations_per_job=0,requirements=[QualityRequirementListItemRequest(settings_id=1,name="name_example",sort_order=-2147483648,filter="filter_example",enabled=True,annotation_type=PatchedQualityRequirementRequestAnnotationType(None),metric=PatchedQualityRequirementRequestMetric(None),required_score=0,parent_requirement=1,iou_threshold=0,point_size=0,point_size_base=PatchedQualityRequirementRequestPointSizeBase(None),line_thickness=0,match_orientation=True,line_orientation_threshold=0,match_groups=True,group_match_threshold=0,check_covered_annotations=True,object_visibility_threshold=0,panoptic_comparison=True,attribute_comparison=PatchedQualityRequirementRequestAttributeComparison(None),),],)# QualitySettingsRequest | (optional)try:(data,response)=api_client.quality_api.update_settings(id,quality_settings_request=quality_settings_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.update_settings(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualitySettings, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this quality requirement.quality_requirement_request=QualityRequirementRequest(settings_id=1,name="name_example",sort_order=-2147483648,filter="filter_example",enabled=True,annotation_type=PatchedQualityRequirementRequestAnnotationType(None),metric=PatchedQualityRequirementRequestMetric(None),required_score=0,parent_requirement=1,iou_threshold=0,point_size=0,point_size_base=PatchedQualityRequirementRequestPointSizeBase(None),line_thickness=0,match_orientation=True,line_orientation_threshold=0,match_groups=True,group_match_threshold=0,check_covered_annotations=True,object_visibility_threshold=0,panoptic_comparison=True,attribute_comparison=PatchedQualityRequirementRequestAttributeComparison(None),)# QualityRequirementRequest | (optional)try:(data,response)=api_client.quality_api.update_settings_requirements(id,quality_requirement_request=quality_requirement_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling QualityApi.update_settings_requirements(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this quality requirement.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[QualityRequirement, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id="id_example"# str | try:api_client.requests_api.create_cancel(id,)exceptexceptions.ApiExceptionase:print("Exception when calling RequestsApi.create_cancel(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
str
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:action="action_example"# str | A simple equality filter for the action field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['action', 'format', 'job_id', 'org', 'org_id', 'project_id', 'status', 'subresource', 'target', 'task_id']. (optional)format="format_example"# str | A simple equality filter for the format field (optional)job_id=1# int | A simple equality filter for the job_id field (optional)org="org_example"# str | A simple equality filter for the org field (optional)org_id=1# int | A simple equality filter for the org_id field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)project_id=1# int | A simple equality filter for the project_id field (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['action', 'created_date', 'status'] (optional)status="queued"# str | A simple equality filter for the status field (optional)subresource="subresource_example"# str | A simple equality filter for the subresource field (optional)target="target_example"# str | A simple equality filter for the target field (optional)task_id=1# int | A simple equality filter for the task_id field (optional)try:(data,response)=api_client.requests_api.list(action=action,filter=filter,format=format,job_id=job_id,org=org,org_id=org_id,page=page,page_size=page_size,project_id=project_id,sort=sort,status=status,subresource=subresource,target=target,task_id=task_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling RequestsApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
action
str
A simple equality filter for the action field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘action’, ‘format’, ‘job_id’, ‘org’, ‘org_id’, ‘project_id’, ‘status’, ‘subresource’, ’target’, ’task_id’].
[optional]
format
str
A simple equality filter for the format field
[optional]
job_id
int
A simple equality filter for the job_id field
[optional]
org
str
A simple equality filter for the org field
[optional]
org_id
int
A simple equality filter for the org_id field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
project_id
int
A simple equality filter for the project_id field
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘action’, ‘created_date’, ‘status’]
[optional]
status
str
A simple equality filter for the status field
[optional]
subresource
str
A simple equality filter for the subresource field
[optional]
target
str
A simple equality filter for the target field
[optional]
task_id
int
A simple equality filter for the task_id field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedRequestList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id="id_example"# str | try:(data,response)=api_client.requests_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling RequestsApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
str
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[Request, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
OpenApi3 schema for this API. Format can be selected via content negotiation. - YAML: application/vnd.oai.openapi - JSON: application/vnd.oai.openapi+json
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:lang="af"# str | (optional)scheme="json"# str | (optional)try:(data,response)=api_client.schema_api.retrieve(lang=lang,scheme=scheme,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling SchemaApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
lang
str
[optional]
scheme
str
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[dict[str, typing.Union[typing.Any, none_type]], urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:directory="directory_example"# str | Directory to browse (optional)search="search_example"# str | Search for specific files (optional)try:(data,response)=api_client.server_api.list_share(directory=directory,search=search,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ServerApi.list_share(): %s\n"%e)
Parameters
Name
Type
Description
Notes
directory
str
Directory to browse
[optional]
search
str
Search for specific files
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[list[FileInfo], urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:try:(data,response)=api_client.server_api.retrieve_about()pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ServerApi.retrieve_about(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[About, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:try:(data,response)=api_client.server_api.retrieve_annotation_formats()pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ServerApi.retrieve_annotation_formats(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[DatasetFormats, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:try:(data,response)=api_client.server_api.retrieve_plugins()pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling ServerApi.retrieve_plugins(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[Plugins, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The new task will not have any attached images or videos. To attach them, use the /api/tasks//data endpoint.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:task_write_request=TaskWriteRequest(name="name_example",project_id=1,owner_id=1,assignee_id=1,bug_tracker="bug_tracker_example",overlap=0,segment_size=0,labels=[PatchedLabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],deleted=True,type=None,svg="svg_example",sublabels=[SublabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],type=None,has_parent=True,),],),],subset="subset_example",target_storage=StorageRequest(location=LocationEnum("cloud_storage"),cloud_storage_id=1,),source_storage=StorageRequest(location=LocationEnum("cloud_storage"),cloud_storage_id=1,),consensus_replicas=0,)# TaskWriteRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.tasks_api.create(task_write_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.create(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[TaskRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The request POST /api/tasks/id/annotations initiates a background process to import annotations into a task. Please, use the GET /api/requests/<rq_id> endpoint for checking status of the process. The rq_id parameter can be found in the response on initiating request.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Annotation file name (optional)format="format_example"# str | Input format name You can get the list of supported formats at: /server/annotation/formats (optional)import_mode="replace"# str | How to import annotations (optional) if omitted the server will use the default value of "replace"location="cloud_storage"# str | where to import the annotation from (optional)use_default_location=True# bool | Use the location that was configured in task to import annotations (optional) if omitted the server will use the default value of Trueannotation_file_request=AnnotationFileRequest(annotation_file=open('/path/to/file','rb'),)# AnnotationFileRequest | (optional)try:api_client.tasks_api.create_annotations(id,cloud_storage_id=cloud_storage_id,filename=filename,format=format,import_mode=import_mode,location=location,use_default_location=use_default_location,annotation_file_request=annotation_file_request,)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.create_annotations(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
cloud_storage_id
int
Storage id
[optional]
filename
str
Annotation file name
[optional]
format
str
Input format name You can get the list of supported formats at: /server/annotation/formats
[optional]
import_mode
str
How to import annotations
[optional] if omitted the server will use the default value of “replace”
location
str
where to import the annotation from
[optional]
use_default_location
bool
Use the location that was configured in task to import annotations
[optional] if omitted the server will use the default value of True
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The backup import process is as follows: The first request POST /api/tasks/backup creates a background job on the server in which the process of a task creating from an uploaded backup is carried out. To check the status of the import process, use GET /api/requests/rq_id, where rq_id is the request ID obtained from the response to the previous request. Once the import completes successfully, the response will contain the ID of the newly created task in the result_id field.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Backup file name (optional)location="local"# str | Where to import the backup file from (optional) if omitted the server will use the default value of "local"org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)task_file_request=TaskFileRequest(task_file=open('/path/to/file','rb'),)# TaskFileRequest | (optional)try:(data,response)=api_client.tasks_api.create_backup(x_organization=x_organization,cloud_storage_id=cloud_storage_id,filename=filename,location=location,org=org,org_id=org_id,task_file_request=task_file_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.create_backup(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
cloud_storage_id
int
Storage id
[optional]
filename
str
Backup file name
[optional]
location
str
Where to import the backup file from
[optional] if omitted the server will use the default value of “local”
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
The request POST /api/<projects|tasks>/id/backup/export will initialize a background process to backup a resource. To check status of the process please, use GET /api/requests/<rq_id> where rq_id is request ID returned in the response for this endpoint.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Backup file name (optional)lightweight=True# bool | Makes a lightweight backup (without media files) for tasks whose media is located in cloud storage (optional) if omitted the server will use the default value of Truelocation="cloud_storage"# str | Where need to save downloaded backup (optional)try:(data,response)=api_client.tasks_api.create_backup_export(id,cloud_storage_id=cloud_storage_id,filename=filename,lightweight=lightweight,location=location,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.create_backup_export(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
cloud_storage_id
int
Storage id
[optional]
filename
str
Backup file name
[optional]
lightweight
bool
Makes a lightweight backup (without media files) for tasks whose media is located in cloud storage
[optional] if omitted the server will use the default value of True
location
str
Where need to save downloaded backup
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Allows to upload data (images, video, etc.) to a task. Supports the TUS open file uploading protocol (https://tus.io/). Supports the following protocols: 1. A single Data request and 2.1. An Upload-Start request 2.2.a. Regular TUS protocol requests (Upload-Length + Chunks) 2.2.b. Upload-Multiple requests 2.3. An Upload-Finish request Requests: - Data - POST, no extra headers or ‘Upload-Start’ + ‘Upload-Finish’ headers. Contains data in the body. - Upload-Start - POST, has an ‘Upload-Start’ header. No body is expected. - Upload-Length - POST, has an ‘Upload-Length’ header (see the TUS specification) - Chunk - HEAD/PATCH (see the TUS specification). Sent to /data/ endpoints. - Upload-Finish - POST, has an ‘Upload-Finish’ header. Can contain data in the body. - Upload-Multiple - POST, has an ‘Upload-Multiple’ header. Contains data in the body. The ‘Upload-Finish’ request allows to specify the uploaded files should be ordered. This may be needed if the files can be sent unordered. To state that the input files are sent ordered, pass an empty list of files in the ‘upload_file_order’ field. If the files are sent unordered, the ordered file list is expected in the ‘upload_file_order’ field. It must be a list of string file paths, relative to the dataset root. Example: files = [ "cats/cat_1.jpg", "dogs/dog2.jpg", "image_3.png", … ] Independently of the file declaration field used (‘client_files’, ‘server_files’, etc.), when the ‘predefined’ sorting method is selected, the uploaded files will be ordered according to the ‘.jsonl’ manifest file, if it is found in the list of files. For archives (e.g. ‘.zip’), a manifest file (’*.jsonl’) is required when using the ‘predefined’ file ordering. Such file must be provided next to the archive in the list of files. Read more about manifest files here: https://docs.cvat.ai/docs/manual/advanced/dataset_manifest/ After all data is sent, the operation status can be retrieved via the GET /api/requests/<rq_id>, where rq_id is request ID returned for this request. Once data is attached to a task, it cannot be detached or replaced.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.upload_finish=True# bool | Finishes data upload. Can be combined with Upload-Start header to create task data with one request (optional)upload_multiple=True# bool | Indicates that data with this request are single or multiple files that should be attached to a task (optional)upload_start=True# bool | Initializes data upload. Optionally, can include upload metadata in the request body. (optional)data_request=DataRequest(chunk_size=0,image_quality=1,start_frame=0,stop_frame=0,frame_filter="frame_filter_example",client_files=[],server_files=[],remote_files=[],use_zip_chunks=False,server_files_exclude=[],cloud_storage_id=1,use_cache=False,copy_data=False,storage_method=StorageMethod("cache"),sorting_method=SortingMethod("lexicographical"),filename_pattern="filename_pattern_example",job_file_mapping=[["a",],],upload_file_order=["upload_file_order_example",],validation_params=DataRequestValidationParams(None),)# DataRequest | (optional)try:(data,response)=api_client.tasks_api.create_data(id,upload_finish=upload_finish,upload_multiple=upload_multiple,upload_start=upload_start,data_request=data_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.create_data(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
upload_finish
bool
Finishes data upload. Can be combined with Upload-Start header to create task data with one request
[optional]
upload_multiple
bool
Indicates that data with this request are single or multiple files that should be attached to a task
[optional]
upload_start
bool
Initializes data upload. Optionally, can include upload metadata in the request body.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[DataResponse, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Request to attach a data to a task has been accepted
-
create_dataset_export
create_dataset_export(
format,
id,
cloud_storage_id=None,
filename=None,
location=None,
save_images=None,
**kwargs
)
Initialize process to export resource as a dataset in a specific format
The request POST /api/<projects|tasks|jobs>/id/dataset/export will initialize a background process to export a dataset. To check status of the process please, use GET /api/requests/<rq_id> where rq_id is request ID returned in the response for this endpoint.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:format="format_example"# str | Desired output format name You can get the list of supported formats at: /server/annotation/formatsid=1# int | A unique integer value identifying this task.cloud_storage_id=1# int | Storage id (optional)filename="filename_example"# str | Desired output file name (optional)location="cloud_storage"# str | Where need to save downloaded dataset (optional)save_images=False# bool | Include images or not (optional) if omitted the server will use the default value of Falsetry:(data,response)=api_client.tasks_api.create_dataset_export(format,id,cloud_storage_id=cloud_storage_id,filename=filename,location=location,save_images=save_images,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.create_dataset_export(): %s\n"%e)
Parameters
Name
Type
Description
Notes
format
str
Desired output format name You can get the list of supported formats at: /server/annotation/formats
id
int
A unique integer value identifying this task.
cloud_storage_id
int
Storage id
[optional]
filename
str
Desired output file name
[optional]
location
str
Where need to save downloaded dataset
[optional]
save_images
bool
Include images or not
[optional] if omitted the server will use the default value of False
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqId, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
All attached jobs, annotations and data will be deleted as well.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.try:api_client.tasks_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.try:api_client.tasks_api.destroy_annotations(id,)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.destroy_annotations(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)assignee="assignee_example"# str | A simple equality filter for the assignee field (optional)dimension="1d"# str | A simple equality filter for the dimension field (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['assignee', 'dimension', 'id', 'media_type', 'mode', 'name', 'owner', 'project_id', 'project_name', 'status', 'subset', 'tracker_link', 'updated_date', 'validation_mode']. There are few examples for complex filtering tasks: - Get all tasks from 1,2,3 projects - { \"and\" : [{ \"in\" : [{ \"var\" : \"project_id\" }, [1, 2, 3]]}]} - Get all completed tasks from 1 project - { \"and\": [{ \"==\": [{ \"var\" : \"status\" }, \"completed\"]}, { \"==\" : [{ \"var\" : \"project_id\"}, 1]}]} (optional)media_type="image"# str | A simple equality filter for the media_type field (optional)mode="annotation"# str | A simple equality filter for the mode field (optional)name="name_example"# str | A simple equality filter for the name field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)owner="owner_example"# str | A simple equality filter for the owner field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)project_id=1# int | A simple equality filter for the project_id field (optional)project_name="project_name_example"# str | A simple equality filter for the project_name field (optional)search="search_example"# str | A search term. Available search_fields: ['assignee', 'name', 'owner', 'project_name', 'subset', 'tracker_link'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['assignee', 'dimension', 'id', 'media_type', 'mode', 'name', 'owner', 'project_id', 'project_name', 'status', 'subset', 'tracker_link', 'updated_date', 'validation_mode'] (optional)status="annotation"# str | A simple equality filter for the status field (optional)subset="subset_example"# str | A simple equality filter for the subset field (optional)tracker_link="tracker_link_example"# str | A simple equality filter for the tracker_link field (optional)validation_mode="gt"# str | A simple equality filter for the validation_mode field (optional)try:(data,response)=api_client.tasks_api.list(x_organization=x_organization,assignee=assignee,dimension=dimension,filter=filter,media_type=media_type,mode=mode,name=name,org=org,org_id=org_id,owner=owner,page=page,page_size=page_size,project_id=project_id,project_name=project_name,search=search,sort=sort,status=status,subset=subset,tracker_link=tracker_link,validation_mode=validation_mode,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
assignee
str
A simple equality filter for the assignee field
[optional]
dimension
str
A simple equality filter for the dimension field
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘assignee’, ‘dimension’, ‘id’, ‘media_type’, ‘mode’, ’name’, ‘owner’, ‘project_id’, ‘project_name’, ‘status’, ‘subset’, ’tracker_link’, ‘updated_date’, ‘validation_mode’]. There are few examples for complex filtering tasks: - Get all tasks from 1,2,3 projects - { "and" : [{ "in" : [{ "var" : "project_id" }, [1, 2, 3]]}]} - Get all completed tasks from 1 project - { "and": [{ "==": [{ "var" : "status" }, "completed"]}, { "==" : [{ "var" : "project_id"}, 1]}]}
[optional]
media_type
str
A simple equality filter for the media_type field
[optional]
mode
str
A simple equality filter for the mode field
[optional]
name
str
A simple equality filter for the name field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
owner
str
A simple equality filter for the owner field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
project_id
int
A simple equality filter for the project_id field
[optional]
project_name
str
A simple equality filter for the project_name field
[optional]
search
str
A search term. Available search_fields: [‘assignee’, ’name’, ‘owner’, ‘project_name’, ‘subset’, ’tracker_link’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘assignee’, ‘dimension’, ‘id’, ‘media_type’, ‘mode’, ’name’, ‘owner’, ‘project_id’, ‘project_name’, ‘status’, ‘subset’, ’tracker_link’, ‘updated_date’, ‘validation_mode’]
[optional]
status
str
A simple equality filter for the status field
[optional]
subset
str
A simple equality filter for the subset field
[optional]
tracker_link
str
A simple equality filter for the tracker_link field
[optional]
validation_mode
str
A simple equality filter for the validation_mode field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedTaskReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.patched_task_write_request=PatchedTaskWriteRequest(name="name_example",project_id=1,owner_id=1,assignee_id=1,bug_tracker="bug_tracker_example",labels=[PatchedLabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],deleted=True,type=None,svg="svg_example",sublabels=[SublabelRequest(id=1,name="name_example",color="color_example",attributes=[AttributeRequest(id=1,name="name_example",mutable=True,input_type=InputTypeEnum("checkbox"),default_value="default_value_example",values=["values_example",],deleted=True,),],type=None,has_parent=True,),],),],subset="subset_example",target_storage=StorageRequest(location=LocationEnum("cloud_storage"),cloud_storage_id=1,),source_storage=StorageRequest(location=LocationEnum("cloud_storage"),cloud_storage_id=1,),organization_id=1,)# PatchedTaskWriteRequest | (optional)try:(data,response)=api_client.tasks_api.partial_update(id,patched_task_write_request=patched_task_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[TaskRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:action="create"# str | id=1# int | A unique integer value identifying this task.patched_labeled_data_request=PatchedLabeledDataRequest(version=0,tags=[LabeledImageRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],),],shapes=[LabeledShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,elements=[SubLabeledShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,),],),],tracks=[LabeledTrackRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],shapes=[TrackedShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],attributes=[AttributeValRequest(spec_id=1,value="value_example",),],id=1,frame=0,),],elements=[SubLabeledTrackRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],shapes=[TrackedShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],attributes=[AttributeValRequest(spec_id=1,value="value_example",),],id=1,frame=0,),],),],),],intervals=[LabeledIntervalRequest(id=1,label_id=0,group=0,source="manual",attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,start=0,stop=0,),],)# PatchedLabeledDataRequest | (optional)try:(data,response)=api_client.tasks_api.partial_update_annotations(action,id,patched_labeled_data_request=patched_labeled_data_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.partial_update_annotations(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[LabeledData, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.patched_data_meta_write_request=PatchedDataMetaWriteRequest(deleted_frames=[0,],cloud_storage_id=1,)# PatchedDataMetaWriteRequest | (optional)try:(data,response)=api_client.tasks_api.partial_update_data_meta(id,patched_data_meta_write_request=patched_data_meta_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.partial_update_data_meta(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[DataMetaRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
WARNING: this operation is not protected from race conditions. It’s up to the user to ensure no parallel calls to this operation happen. It affects image access, including exports with images, backups, chunk downloading etc.
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.patched_task_validation_layout_write_request=PatchedTaskValidationLayoutWriteRequest(disabled_frames=[0,],frame_selection_method=None,honeypot_real_frames=[0,],)# PatchedTaskValidationLayoutWriteRequest | (optional)try:(data,response)=api_client.tasks_api.partial_update_validation_layout(id,patched_task_validation_layout_write_request=patched_task_validation_layout_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.partial_update_validation_layout(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[TaskValidationLayoutRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.try:(data,response)=api_client.tasks_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[TaskRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.try:(data,response)=api_client.tasks_api.retrieve_annotations(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.retrieve_annotations(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[LabeledData, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.type="chunk"# str | Specifies the type of the requested datanumber=1# int | A unique number value identifying chunk or frame (optional)quality="compressed"# str | Specifies the quality level of the requested data (optional)try:api_client.tasks_api.retrieve_data(id,type,number=number,quality=quality,)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.retrieve_data(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
type
str
Specifies the type of the requested data
number
int
A unique number value identifying chunk or frame
[optional]
quality
str
Specifies the quality level of the requested data
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
* X-Checksum - Data checksum, applicable for chunks only * X-Chunk-Size - Decoded chunk size in bytes, applicable for chunks only * X-Updated-Date - Data update date, applicable for chunks only
206
Partial chunk data
* X-Checksum - Data checksum, applicable for chunks only * X-Chunk-Size - Decoded chunk size in bytes, applicable for chunks only * X-Updated-Date - Data update date, applicable for chunks only
416
Requested range is not satisfiable
* X-Chunk-Size - Decoded chunk size in bytes, applicable for chunks only
retrieve_data_meta
retrieve_data_meta(
id,
**kwargs
)
Get metainformation for media files in a task
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.try:(data,response)=api_client.tasks_api.retrieve_data_meta(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.retrieve_data_meta(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[DataMetaRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.prefer="Prefer_example"# str | RFC 7240 preference token. Send `handling=empty` to receive a 204 No Content response when no media-derived preview exists. Without the preference, the server returns a default placeholder image with status 200. (optional)try:api_client.tasks_api.retrieve_preview(id,prefer=prefer,)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.retrieve_preview(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
prefer
str
RFC 7240 preference token. Send handling=empty to receive a 204 No Content response when no media-derived preview exists. Without the preference, the server returns a default placeholder image with status 200.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
No media-derived preview is available. The client should render a placeholder image. Only returned when the request opts in via `Prefer: handling=empty`.
-
404
Task image preview not found
-
retrieve_status
retrieve_status(
id,
**kwargs
)
Get the creation status of a task
This method is deprecated and will be removed in one of the next releases. To check status of task creation, use new common API for managing background operations: GET /api/requests/?action=create&task_id=<task_id>
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.try:(data,response)=api_client.tasks_api.retrieve_status(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.retrieve_status(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[RqStatus, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.try:(data,response)=api_client.tasks_api.retrieve_validation_layout(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.retrieve_validation_layout(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this task.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[TaskValidationLayoutRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this task.labeled_data_request=LabeledDataRequest(version=0,tags=[LabeledImageRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],),],shapes=[LabeledShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,elements=[SubLabeledShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,),],),],tracks=[LabeledTrackRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],shapes=[TrackedShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],attributes=[AttributeValRequest(spec_id=1,value="value_example",),],id=1,frame=0,),],elements=[SubLabeledTrackRequest(id=1,label_id=0,group=0,source="manual",frame=0,attributes=[AttributeValRequest(spec_id=1,value="value_example",),],shapes=[TrackedShapeRequest(type=ShapeType("rectangle"),occluded=False,outside=False,z_order=0,rotation=0.0,points=[3.14,],attributes=[AttributeValRequest(spec_id=1,value="value_example",),],id=1,frame=0,),],),],),],intervals=[LabeledIntervalRequest(id=1,label_id=0,group=0,source="manual",attributes=[AttributeValRequest(spec_id=1,value="value_example",),],score=1.0,start=0,stop=0,),],)# LabeledDataRequest | (optional)try:api_client.tasks_api.update_annotations(id,labeled_data_request=labeled_data_request,)exceptexceptions.ApiExceptionase:print("Exception when calling TasksApi.update_annotations(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this user.try:api_client.users_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling UsersApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this user.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['first_name', 'id', 'is_active', 'last_name', 'username']. (optional)first_name="first_name_example"# str | A simple equality filter for the first_name field (optional)is_active=True# bool | A simple equality filter for the is_active field (optional)last_name="last_name_example"# str | A simple equality filter for the last_name field (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)search="search_example"# str | A search term. Available search_fields: ['first_name', 'last_name', 'username'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['first_name', 'id', 'is_active', 'last_name', 'username'] (optional)username="username_example"# str | A simple equality filter for the username field (optional)try:(data,response)=api_client.users_api.list(x_organization=x_organization,filter=filter,first_name=first_name,is_active=is_active,last_name=last_name,org=org,org_id=org_id,page=page,page_size=page_size,search=search,sort=sort,username=username,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling UsersApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘first_name’, ‘id’, ‘is_active’, ’last_name’, ‘username’].
[optional]
first_name
str
A simple equality filter for the first_name field
[optional]
is_active
bool
A simple equality filter for the is_active field
[optional]
last_name
str
A simple equality filter for the last_name field
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
search
str
A search term. Available search_fields: [‘first_name’, ’last_name’, ‘username’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘first_name’, ‘id’, ‘is_active’, ’last_name’, ‘username’]
[optional]
username
str
A simple equality filter for the username field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedMetaUserList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this user.patched_user_request=PatchedUserRequest(username="A",first_name="first_name_example",last_name="last_name_example",email="email_example",groups=["groups_example",],is_staff=True,is_superuser=True,is_active=True,)# PatchedUserRequest | (optional)try:(data,response)=api_client.users_api.partial_update(id,patched_user_request=patched_user_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling UsersApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[MetaUser, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this user.try:(data,response)=api_client.users_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling UsersApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this user.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[MetaUser, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
Method returns an instance of a user who is currently authenticated
Example
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:try:(data,response)=api_client.users_api.retrieve_self()pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling UsersApi.retrieve_self(): %s\n"%e)
Parameters
This endpoint does not need any parameter.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[MetaUser, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:webhook_write_request=WebhookWriteRequest(target_url="target_url_example",description="description_example",type=WebhookType("organization"),content_type=WebhookContentType("application/json"),secret="secret_example",is_active=True,enable_ssl=True,project_id=1,events=[EventsEnum("completed:request[calculate:quality]"),],)# WebhookWriteRequest | x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)try:(data,response)=api_client.webhooks_api.create(webhook_write_request,x_organization=x_organization,org=org,org_id=org_id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.create(): %s\n"%e)
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[WebhookRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:delivery_id="4"# str | id=1# int | A unique integer value identifying this webhook.try:api_client.webhooks_api.create_deliveries_redelivery(delivery_id,id,)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.create_deliveries_redelivery(): %s\n"%e)
Parameters
Name
Type
Description
Notes
delivery_id
str
id
int
A unique integer value identifying this webhook.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this webhook.try:(data,response)=api_client.webhooks_api.create_ping(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.create_ping(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this webhook.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[WebhookDeliveryRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this webhook.try:api_client.webhooks_api.destroy(id,)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.destroy(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this webhook.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[None, urllib3.HTTPResponse].
Returns a tuple with 2 values: (None, raw_response).
This endpoint does not have any return value, so None is always returned as the first value.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:x_organization="X-Organization_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)filter="filter_example"# str | JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {\"and\":[{\"==\":[{\"var\":\"owner\"},\"<user>\"]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: ['description', 'id', 'owner', 'project_id', 'target_url', 'type', 'updated_date']. (optional)org="org_example"# str | Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A non-empty value selects that organization. (optional)org_id=1# int | Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value (\"\") selects the personal sandbox workspace only. A positive integer selects that organization. (optional)owner="owner_example"# str | A simple equality filter for the owner field (optional)page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)project_id=1# int | A simple equality filter for the project_id field (optional)search="search_example"# str | A search term. Available search_fields: ['description', 'owner', 'target_url'] (optional)sort="sort_example"# str | Which field to use when ordering the results. Available ordering_fields: ['description', 'id', 'owner', 'project_id', 'target_url', 'type', 'updated_date'] (optional)target_url="target_url_example"# str | A simple equality filter for the target_url field (optional)type="organization"# str | A simple equality filter for the type field (optional)try:(data,response)=api_client.webhooks_api.list(x_organization=x_organization,filter=filter,org=org,org_id=org_id,owner=owner,page=page,page_size=page_size,project_id=project_id,search=search,sort=sort,target_url=target_url,type=type,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.list(): %s\n"%e)
Parameters
Name
Type
Description
Notes
x_organization
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
filter
str
JSON Logic filter. This filter can be used to perform complex filtering by grouping rules. For example, using such a filter you can get all resources created by you: - {"and":[{"==":[{"var":"owner"},""]}]} Details about the syntax used can be found at the link: https://jsonlogic.com/ Available filter_fields: [‘description’, ‘id’, ‘owner’, ‘project_id’, ’target_url’, ’type’, ‘updated_date’].
[optional]
org
str
Organization unique slug. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A non-empty value selects that organization.
[optional]
org_id
int
Organization unique id. If omitted, results from all organizations available to the user are returned (unfiltered). An empty value ("") selects the personal sandbox workspace only. A positive integer selects that organization.
[optional]
owner
str
A simple equality filter for the owner field
[optional]
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
project_id
int
A simple equality filter for the project_id field
[optional]
search
str
A search term. Available search_fields: [‘description’, ‘owner’, ’target_url’]
[optional]
sort
str
Which field to use when ordering the results. Available ordering_fields: [‘description’, ‘id’, ‘owner’, ‘project_id’, ’target_url’, ’type’, ‘updated_date’]
[optional]
target_url
str
A simple equality filter for the target_url field
[optional]
type
str
A simple equality filter for the type field
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedWebhookReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this webhook.page=1# int | A page number within the paginated result set. (optional)page_size=1# int | Number of results to return per page. (optional)try:(data,response)=api_client.webhooks_api.list_deliveries(id,page=page,page_size=page_size,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.list_deliveries(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this webhook.
page
int
A page number within the paginated result set.
[optional]
page_size
int
Number of results to return per page.
[optional]
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[PaginatedWebhookDeliveryReadList, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this webhook.patched_webhook_write_request=PatchedWebhookWriteRequest(target_url="target_url_example",description="description_example",content_type=WebhookContentType("application/json"),secret="secret_example",is_active=True,enable_ssl=True,events=[EventsEnum("completed:request[calculate:quality]"),],)# PatchedWebhookWriteRequest | (optional)try:(data,response)=api_client.webhooks_api.partial_update(id,patched_webhook_write_request=patched_webhook_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.partial_update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[WebhookRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this webhook.try:(data,response)=api_client.webhooks_api.retrieve(id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.retrieve(): %s\n"%e)
Parameters
Name
Type
Description
Notes
id
int
A unique integer value identifying this webhook.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[WebhookRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:delivery_id="4"# str | id=1# int | A unique integer value identifying this webhook.try:(data,response)=api_client.webhooks_api.retrieve_deliveries(delivery_id,id,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.retrieve_deliveries(): %s\n"%e)
Parameters
Name
Type
Description
Notes
delivery_id
str
id
int
A unique integer value identifying this webhook.
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[WebhookDeliveryRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:type="all"# str | Type of webhook (optional) if omitted the server will use the default value of "all"try:(data,response)=api_client.webhooks_api.retrieve_events(type=type,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.retrieve_events(): %s\n"%e)
Parameters
Name
Type
Description
Notes
type
str
Type of webhook
[optional] if omitted the server will use the default value of “all”
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[Events, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
frompprintimportpprintfromcvat_sdk.api_clientimportConfiguration,ApiClient,exceptionsfromcvat_sdk.api_client.modelsimport*# Set up an API client# Read Configuration class docs for more info about parameters and authentication methodsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)withApiClient(configuration)asapi_client:id=1# int | A unique integer value identifying this webhook.webhook_write_request=WebhookWriteRequest(target_url="target_url_example",description="description_example",type=WebhookType("organization"),content_type=WebhookContentType("application/json"),secret="secret_example",is_active=True,enable_ssl=True,project_id=1,events=[EventsEnum("completed:request[calculate:quality]"),],)# WebhookWriteRequest | try:(data,response)=api_client.webhooks_api.update(id,webhook_write_request,)pprint(data)exceptexceptions.ApiExceptionase:print("Exception when calling WebhooksApi.update(): %s\n"%e)
There are also optional kwargs that control the function invocation behavior.
Read more here.
Returned values
Returned type: Tuple[WebhookRead, urllib3.HTTPResponse].
Returns a tuple with 2 values: (parsed_response, raw_response).
The first value is a model parsed from the response data.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. Read more about invocation parameters
and returned values here.
must be one of [“missing_annotation”, “extra_annotation”, “mismatching_label”, “mismatching_direction”, “mismatching_attributes”, “mismatching_groups”, “covered_annotation”, ]
2.1.2.11 - AnnotationFileRequest class reference
Properties
Name
Type
Description
Notes
annotation_file
file_type
2.1.2.12 - AnnotationGuideRead class reference
Properties
Name
Type
Description
Notes
id
int
[optional] [readonly]
task_id
int, none_type
[optional] [readonly]
project_id
int, none_type
[optional] [readonly]
created_date
datetime
[optional] [readonly]
updated_date
datetime
[optional] [readonly]
markdown
str
[optional] [readonly]
2.1.2.13 - AnnotationGuideWriteRequest class reference
Image quality to use during annotation, required for image and video-based tasks
[optional]
start_frame
int
First frame index
[optional]
stop_frame
int
Last frame index
[optional]
frame_filter
str
Frame filter. The only supported syntax is: ‘step=N’
[optional]
client_files
[file_type]
Uploaded files. Must contain all files from job_file_mapping if job_file_mapping is not empty.
[optional] if omitted the server will use the default value of []
server_files
[str]
Paths to files from a file share mounted on the server, or from a cloud storage. Must contain all files from job_file_mapping if job_file_mapping is not empty.
[optional] if omitted the server will use the default value of []
remote_files
[str]
Direct download URLs for files. Must contain all files from job_file_mapping if job_file_mapping is not empty.
[optional] if omitted the server will use the default value of []
use_zip_chunks
bool
When true, video chunks will be represented as zip archives with decoded video frames. When false, video chunks are represented as video segments
[optional] if omitted the server will use the default value of False
server_files_exclude
[str]
Paths to files and directories from a file share mounted on the server, or from a cloud storage that should be excluded from the directories specified in server_files. This option cannot be used together with filename_pattern. The server_files_exclude parameter cannot be used to exclude a part of dataset from an archive. Examples: Exclude all files from subfolder ‘sub/sub_1/sub_2’and single file ‘sub/image.jpg’ from specified folder: server_files = [‘sub/’], server_files_exclude = [‘sub/sub_1/sub_2/’, ‘sub/image.jpg’] Exclude all cloud storage files with prefix ‘sub’ from the content of manifest file: server_files = [‘manifest.jsonl’], server_files_exclude = [‘sub/’]
[optional] if omitted the server will use the default value of []
cloud_storage_id
int, none_type
If not null, the files referenced by server_files will be retrieved from the cloud storage with the specified ID. The cloud storages applicable depend on the context. In the user sandbox, only the user sandbox cloud storages can be used. In an organization, only the organization cloud storages can be used.
[optional] if omitted the server will use the default value of False
copy_data
bool
Copy data from the server file share to CVAT during the task creation. This will create a copy of the data, making the server independent from the file share availability
[optional] if omitted the server will use the default value of False
Represents a file-to-job mapping. Useful to specify a custom job configuration during task creation. This option is not compatible with most other job split-related options. Files in the jobs must not overlap or repeat. Job file mapping files must be a subset of the input files. If directories are specified in server_files, all files obtained by recursive search in the specified directories will be used as input files. In case of missing items in the input files, an error will be raised. Example: [ ["file1.jpg", "file2.jpg"], # job #1 files ["file3.png"], # job #2 files ["file4.jpg", "file5.png", "file6.bmp"], # job #3 files ]
[optional]
upload_file_order
[str]
Allows to specify file order for client_file uploads. Only valid with the "predefined" sorting method selected. To state that the input files are sent in the correct order, pass an empty list. If you want to send files in an arbitrary order and reorder them afterwards on the server, pass the list of file names in the required order.
The seed value for the random number generator. The same value will produce the same frame sets. Applicable only to random frame selection methods. By default, a random value is used.
[optional]
frames
[str]
The list of file names to be included in the validation set. Applicable only to the "manual" frame selection method. Can only be used for images.
[optional]
frame_count
int
The number of frames to be included in the validation set. Applicable only to the "random_uniform" frame selection method
[optional]
frame_share
float
The share of frames to be included in the validation set. Applicable only to the "random_uniform" frame selection method
[optional]
frames_per_job_count
int
The number of frames to be included in the validation set from each annotation job. Applicable only to the "random_per_job" frame selection method
[optional]
frames_per_job_share
float
The share of frames to be included in the validation set from each annotation job. Applicable only to the "random_per_job" frame selection method
The number of frames included in the GT job. Applicable only to the "random_uniform" frame selection method
[optional]
frame_share
float
The share of frames included in the GT job. Applicable only to the "random_uniform" frame selection method
[optional]
frames_per_job_count
int
The number of frames included in the GT job from each annotation job. Applicable only to the "random_per_job" frame selection method
[optional]
frames_per_job_share
float
The share of frames included in the GT job from each annotation job. Applicable only to the "random_per_job" frame selection method
[optional]
random_seed
int
The seed value for the random number generator. The same value will produce the same frame sets. Applicable only to random frame selection methods. By default, a random value is used.
[optional]
frames
[int]
The list of frame ids. Applicable only to the "manual" frame selection method
[optional]
2.1.2.87 - Label class reference
Properties
Name
Type
Description
Notes
name
str
id
int
[optional]
color
str
The hex value for the RGB color. Will be generated automatically, unless specified explicitly.
The method to use for frame selection of new real frames for honeypots in the job * random_uniform - RANDOM_UNIFORM * random_per_job - RANDOM_PER_JOB * manual - MANUAL
[optional]
honeypot_real_frames
[int]
The list of frame ids. Applicable only to the "manual" frame selection method
[optional]
2.1.2.143 - PatchedJobWriteRequest class reference
Defines the minimal quality requirements in terms of the selected target metric.
[optional]
parent_requirement
int, none_type
The parent requirement. Child requirements inherit comparison settings from it.
[optional]
iou_threshold
float, none_type
The overlap threshold used for distinction between matched / unmatched objects. The specific meaning can vary depending on the shape type: for rectangles, polygons, ellipses, lines and masks it’s the IoU threshold; for points and skeletons, it’s the OKS threshold.
[optional]
point_size
float, none_type
The point "size" (the OKS sigma), as a fraction of the object size, defined by the point size base. Corresponds to the standard deviation of the keypoint position. Larger values give larger areas around the GT points, where the checked points are accepted. Read more about the point matching in the documentation.
Thickness of polylines, relatively to the (image area) ^ 0.5. The distance to the boundary around the GT line, inside of which the checked line points should be
[optional]
match_orientation
bool, none_type
Enables or disables polyline orientation comparison
[optional]
line_orientation_threshold
float, none_type
The minimal gain in the GT IoU between the given and reversed line directions to consider the line inverted. Only used when the ‘match_orientation’ parameter is true
[optional]
match_groups
bool, none_type
Enables or disables annotation group checks. Only annotations of the same shape type can form matching groups.
[optional]
group_match_threshold
float, none_type
Minimal IoU for groups to be considered matching. Only used when the ‘match_groups’ parameter is true
[optional]
check_covered_annotations
bool, none_type
Check for partially-covered annotations, useful in segmentation tasks
[optional]
object_visibility_threshold
float, none_type
Minimal visible area percent of the spatial annotations (polygons, masks) for reporting covered annotations. Only used when the ‘object_visibility_threshold’ parameter is true
[optional]
panoptic_comparison
bool, none_type
Use only the visible part of the masks and polygons in comparisons
2.1.2.151 - PatchedQualityRequirementRequestAnnotationType class reference
Properties
Name
Type
Description
Notes
2.1.2.152 - PatchedQualityRequirementRequestAttributeComparison class reference
Incremental attribute comparison settings. The default rule applies to attributes without an override; rules override behavior for individual AttributeSpec ids.
2.1.2.154 - PatchedQualityRequirementRequestPointSizeBase class reference
When comparing point annotations (including both separate points and point groups), the point size parameter defines matching area for each GT point based to the object size. The point size base parameter allows to configure how to determine the object size. If image_size, the image size is used. Useful if each point annotation represents a separate object or boxes grouped with points do not represent object boundaries. If group_bbox_size, the object size is based on the point group bbox size. Useful if each point group represents an object or there is a bbox grouped with points, representing the object size. * `image_size` - IMAGE_SIZE * `group_bbox_size` - GROUP_BBOX_SIZE
Properties
Name
Type
Description
Notes
2.1.2.155 - PatchedQualitySettingsRequest class reference
Properties
Name
Type
Description
Notes
job_filter
str
A JSON-based logic expression used to filter jobs for quality validation. The filter supports various terms to specify conditions on job: [‘assignee’, ‘id’, ‘stage’, ‘state’, ’task_id’, ’task_name’, ’type’]
[optional]
inherit
bool
Allow using project settings when computing task quality. Only applicable to task quality settings inside projects
[optional]
max_validations_per_job
int
The maximum number of job validation attempts for the job assignee. The job can be automatically accepted if the job quality is above the required threshold, defined by the target threshold parameter.
The method to use for frame selection of new real frames for honeypots in the task * random_uniform - RANDOM_UNIFORM * random_per_job - RANDOM_PER_JOB * manual - MANUAL
[optional]
honeypot_real_frames
[int]
The list of frame ids. Applicable only to the "manual" frame selection method
[optional]
2.1.2.157 - PatchedTaskWriteRequest class reference
The overlap threshold used for distinction between matched / unmatched objects. The specific meaning can vary depending on the shape type: for rectangles, polygons, ellipses, lines and masks it’s the IoU threshold; for points and skeletons, it’s the OKS threshold.
[optional]
point_size
float, none_type
The point "size" (the OKS sigma), as a fraction of the object size, defined by the point size base. Corresponds to the standard deviation of the keypoint position. Larger values give larger areas around the GT points, where the checked points are accepted. Read more about the point matching in the documentation.
Thickness of polylines, relatively to the (image area) ^ 0.5. The distance to the boundary around the GT line, inside of which the checked line points should be
[optional]
match_orientation
bool, none_type
Enables or disables polyline orientation comparison
[optional]
line_orientation_threshold
float, none_type
The minimal gain in the GT IoU between the given and reversed line directions to consider the line inverted. Only used when the ‘match_orientation’ parameter is true
[optional]
match_groups
bool, none_type
Enables or disables annotation group checks. Only annotations of the same shape type can form matching groups.
[optional]
group_match_threshold
float, none_type
Minimal IoU for groups to be considered matching. Only used when the ‘match_groups’ parameter is true
[optional]
check_covered_annotations
bool, none_type
Check for partially-covered annotations, useful in segmentation tasks
[optional]
object_visibility_threshold
float, none_type
Minimal visible area percent of the spatial annotations (polygons, masks) for reporting covered annotations. Only used when the ‘object_visibility_threshold’ parameter is true
[optional]
panoptic_comparison
bool, none_type
Use only the visible part of the masks and polygons in comparisons
2.1.2.188 - QualityRequirementAttributeComparison class reference
Incremental attribute comparison settings. The default rule applies to attributes without an override; rules override behavior for individual AttributeSpec ids.
Defines the minimal quality requirements in terms of the selected target metric.
[optional]
parent_requirement
int, none_type
Required for root requirements and forbidden for nested requirements. Must identify an existing requirement from the selected quality settings.
[optional]
iou_threshold
float, none_type
The overlap threshold used for distinction between matched / unmatched objects. The specific meaning can vary depending on the shape type: for rectangles, polygons, ellipses, lines and masks it’s the IoU threshold; for points and skeletons, it’s the OKS threshold.
[optional]
point_size
float, none_type
The point "size" (the OKS sigma), as a fraction of the object size, defined by the point size base. Corresponds to the standard deviation of the keypoint position. Larger values give larger areas around the GT points, where the checked points are accepted. Read more about the point matching in the documentation.
Thickness of polylines, relatively to the (image area) ^ 0.5. The distance to the boundary around the GT line, inside of which the checked line points should be
[optional]
match_orientation
bool, none_type
Enables or disables polyline orientation comparison
[optional]
line_orientation_threshold
float, none_type
The minimal gain in the GT IoU between the given and reversed line directions to consider the line inverted. Only used when the ‘match_orientation’ parameter is true
[optional]
match_groups
bool, none_type
Enables or disables annotation group checks. Only annotations of the same shape type can form matching groups.
[optional]
group_match_threshold
float, none_type
Minimal IoU for groups to be considered matching. Only used when the ‘match_groups’ parameter is true
[optional]
check_covered_annotations
bool, none_type
Check for partially-covered annotations, useful in segmentation tasks
[optional]
object_visibility_threshold
float, none_type
Minimal visible area percent of the spatial annotations (polygons, masks) for reporting covered annotations. Only used when the ‘object_visibility_threshold’ parameter is true
[optional]
panoptic_comparison
bool, none_type
Use only the visible part of the masks and polygons in comparisons
Defines the minimal quality requirements in terms of the selected target metric.
[optional]
parent_requirement
int, none_type
The parent requirement. Child requirements inherit comparison settings from it.
[optional]
iou_threshold
float, none_type
The overlap threshold used for distinction between matched / unmatched objects. The specific meaning can vary depending on the shape type: for rectangles, polygons, ellipses, lines and masks it’s the IoU threshold; for points and skeletons, it’s the OKS threshold.
[optional]
point_size
float, none_type
The point "size" (the OKS sigma), as a fraction of the object size, defined by the point size base. Corresponds to the standard deviation of the keypoint position. Larger values give larger areas around the GT points, where the checked points are accepted. Read more about the point matching in the documentation.
Thickness of polylines, relatively to the (image area) ^ 0.5. The distance to the boundary around the GT line, inside of which the checked line points should be
[optional]
match_orientation
bool, none_type
Enables or disables polyline orientation comparison
[optional]
line_orientation_threshold
float, none_type
The minimal gain in the GT IoU between the given and reversed line directions to consider the line inverted. Only used when the ‘match_orientation’ parameter is true
[optional]
match_groups
bool, none_type
Enables or disables annotation group checks. Only annotations of the same shape type can form matching groups.
[optional]
group_match_threshold
float, none_type
Minimal IoU for groups to be considered matching. Only used when the ‘match_groups’ parameter is true
[optional]
check_covered_annotations
bool, none_type
Check for partially-covered annotations, useful in segmentation tasks
[optional]
object_visibility_threshold
float, none_type
Minimal visible area percent of the spatial annotations (polygons, masks) for reporting covered annotations. Only used when the ‘object_visibility_threshold’ parameter is true
[optional]
panoptic_comparison
bool, none_type
Use only the visible part of the masks and polygons in comparisons
Defines the minimal quality requirements in terms of the selected target metric.
[optional]
parent_requirement
int, none_type
The parent requirement. Child requirements inherit comparison settings from it.
[optional]
iou_threshold
float, none_type
The overlap threshold used for distinction between matched / unmatched objects. The specific meaning can vary depending on the shape type: for rectangles, polygons, ellipses, lines and masks it’s the IoU threshold; for points and skeletons, it’s the OKS threshold.
[optional]
point_size
float, none_type
The point "size" (the OKS sigma), as a fraction of the object size, defined by the point size base. Corresponds to the standard deviation of the keypoint position. Larger values give larger areas around the GT points, where the checked points are accepted. Read more about the point matching in the documentation.
Thickness of polylines, relatively to the (image area) ^ 0.5. The distance to the boundary around the GT line, inside of which the checked line points should be
[optional]
match_orientation
bool, none_type
Enables or disables polyline orientation comparison
[optional]
line_orientation_threshold
float, none_type
The minimal gain in the GT IoU between the given and reversed line directions to consider the line inverted. Only used when the ‘match_orientation’ parameter is true
[optional]
match_groups
bool, none_type
Enables or disables annotation group checks. Only annotations of the same shape type can form matching groups.
[optional]
group_match_threshold
float, none_type
Minimal IoU for groups to be considered matching. Only used when the ‘match_groups’ parameter is true
[optional]
check_covered_annotations
bool, none_type
Check for partially-covered annotations, useful in segmentation tasks
[optional]
object_visibility_threshold
float, none_type
Minimal visible area percent of the spatial annotations (polygons, masks) for reporting covered annotations. Only used when the ‘object_visibility_threshold’ parameter is true
[optional]
panoptic_comparison
bool, none_type
Use only the visible part of the masks and polygons in comparisons
Defines the minimal quality requirements in terms of the selected target metric.
[optional]
parent_requirement
int, none_type
The parent requirement. Child requirements inherit comparison settings from it.
[optional]
iou_threshold
float, none_type
The overlap threshold used for distinction between matched / unmatched objects. The specific meaning can vary depending on the shape type: for rectangles, polygons, ellipses, lines and masks it’s the IoU threshold; for points and skeletons, it’s the OKS threshold.
[optional]
point_size
float, none_type
The point "size" (the OKS sigma), as a fraction of the object size, defined by the point size base. Corresponds to the standard deviation of the keypoint position. Larger values give larger areas around the GT points, where the checked points are accepted. Read more about the point matching in the documentation.
Thickness of polylines, relatively to the (image area) ^ 0.5. The distance to the boundary around the GT line, inside of which the checked line points should be
[optional]
match_orientation
bool, none_type
Enables or disables polyline orientation comparison
[optional]
line_orientation_threshold
float, none_type
The minimal gain in the GT IoU between the given and reversed line directions to consider the line inverted. Only used when the ‘match_orientation’ parameter is true
[optional]
match_groups
bool, none_type
Enables or disables annotation group checks. Only annotations of the same shape type can form matching groups.
[optional]
group_match_threshold
float, none_type
Minimal IoU for groups to be considered matching. Only used when the ‘match_groups’ parameter is true
[optional]
check_covered_annotations
bool, none_type
Check for partially-covered annotations, useful in segmentation tasks
[optional]
object_visibility_threshold
float, none_type
Minimal visible area percent of the spatial annotations (polygons, masks) for reporting covered annotations. Only used when the ‘object_visibility_threshold’ parameter is true
[optional]
panoptic_comparison
bool, none_type
Use only the visible part of the masks and polygons in comparisons
A JSON-based logic expression used to filter jobs for quality validation. The filter supports various terms to specify conditions on job: [‘assignee’, ‘id’, ‘stage’, ‘state’, ’task_id’, ’task_name’, ’type’]
[optional]
inherit
bool
Allow using project settings when computing task quality. Only applicable to task quality settings inside projects
[optional]
max_validations_per_job
int
The maximum number of job validation attempts for the job assignee. The job can be automatically accepted if the job quality is above the required threshold, defined by the target threshold parameter.
2.1.2.195 - QualitySettingsRequest class reference
Properties
Name
Type
Description
Notes
job_filter
str
A JSON-based logic expression used to filter jobs for quality validation. The filter supports various terms to specify conditions on job: [‘assignee’, ‘id’, ‘stage’, ‘state’, ’task_id’, ’task_name’, ’type’]
[optional]
inherit
bool
Allow using project settings when computing task quality. Only applicable to task quality settings inside projects
[optional]
max_validations_per_job
int
The maximum number of job validation attempts for the job assignee. The job can be automatically accepted if the job quality is above the required threshold, defined by the target threshold parameter.
must be one of [“accuracy”, “precision”, “recall”, “jaccard_index”, “dice”, “mean_accuracy”, “mean_precision”, “mean_recall”, “mean_jaccard_index”, “mean_dice”, “label_accuracy”, “label_precision”, “label_recall”, “label_jaccard_index”, “label_dice”, ]
The seed value for the random number generator. The same value will produce the same frame sets. Applicable only to random frame selection methods. By default, a random value is used.
[optional]
frames
[str]
The list of file names to be included in the validation set. Applicable only to the "manual" frame selection method. Can only be used for images.
[optional]
frame_count
int
The number of frames to be included in the validation set. Applicable only to the "random_uniform" frame selection method
[optional]
frame_share
float
The share of frames to be included in the validation set. Applicable only to the "random_uniform" frame selection method
[optional]
frames_per_job_count
int
The number of frames to be included in the validation set from each annotation job. Applicable only to the "random_per_job" frame selection method
[optional]
frames_per_job_share
float
The share of frames to be included in the validation set from each annotation job. Applicable only to the "random_per_job" frame selection method
[optional]
2.1.2.238 - WebhookContentType class reference
`application/json` - JSON
Properties
Name
Type
Description
Notes
value
str
* application/json - JSON
defaults to “application/json”, must be one of [“application/json”, ]
The low-level API is useful if you need to work directly with REST API, but want
to have data validation and syntax assistance from your code editor. The code
on this layer is autogenerated.
Code of this component is located in cvat_sdk.api_client.
Example
Let’s see how a task with local files can be created. We will use the basic auth
to make things simpler.
fromtimeimportsleepfromcvat_sdk.api_clientimportConfiguration,ApiClient,models,apis,exceptionsconfiguration=Configuration(host="http://localhost",username='YOUR_USERNAME',password='YOUR_PASSWORD',)# Enter a context with an instance of the API clientwithApiClient(configuration)asapi_client:# Parameters can be passed as a plain dict with JSON-serialized data# or as model objects (from cvat_sdk.api_client.models), including# mixed variants.## In case of dicts, keys must be the same as members of models.I<ModelName># interfaces and values must be convertible to the corresponding member# value types (e.g. a date or string enum value can be parsed from a string).## In case of model objects, data must be of the corresponding# models.<ModelName> types.## Let's use a dict here. It should look like models.ITaskWriteRequesttask_spec={'name':'example task',"labels":[{"name":"car","color":"#ff00ff","attributes":[{"name":"a","mutable":True,"input_type":"number","default_value":"5","values":["4","5","6"]}]}],}try:# Apis can be accessed as ApiClient class members# We use different models for input and output data. For input data,# models are typically called like "*Request". Output data models have# no suffix.(task,response)=api_client.tasks_api.create(task_spec)exceptexceptions.ApiExceptionase:# We can catch the basic exception type, or a derived typeprint("Exception when trying to create a task: %s\n"%e)# Here we will use models instead of a dicttask_data=models.DataRequest(image_quality=75,client_files=[open('image1.jpg','rb'),open('image2.jpg','rb'),],)# If we pass binary file objects, we need to specify content type.(result,response)=api_client.tasks_api.create_data(task.id,data_request=task_data,_content_type="multipart/form-data",# we can choose to check the response status manually# and disable the response data parsing_check_status=False,_parse_response=False)assertresponse.status==202,response.msg# Wait till task data is processedfor_inrange(100):request_details,response=api_client.requests_api.retrieve(result.rq_id)status,message=request_details.status,request_details.messageifstatus.valuein{'finished','failed'}:breaksleep(0.1)assertstatus.value=='finished',status.message# Update the task object and check the task size(task,_)=api_client.tasks_api.retrieve(task.id)asserttask.size==4
ApiClient and configuration
The starting point in the low-level API is the cvat_sdk.api_client.ApiClient class.
It encapsulates session and connection logic, manages headers and cookies,
and provides access to various APIs.
To create an instance of ApiClient, you need to set up a cvat_sdk.api_client.Configuration
object and pass it to the ApiClient class constructor. Additional connection-specific
options, such as extra headers and cookies can be specified in the class constructor.
ApiClient implements the context manager protocol. Typically, you create ApiClient this way:
After creating an ApiClient instance, you can send requests to various server endpoints
via *_api member properties and directly, using the rest_client member.
Read more about API wrappers below.
Typically, the first thing you do with ApiClient is log in.
Read more about authentication options below.
Authentication
CVAT supports 3 authentication options:
Personal Access Token (PAT) authentication, with an access token value
Basic authentication, with a username and a password
Session authentication, with a session ID and a CSRF token
Legacy token authentication, with an API key (deprecated)
Personal Access Token (PAT) authentication requires a token that can be configured
in the user settings section in the UI. It is the recommended authentication option
for most API clients. Read more.
Basic authentication requires a username and password pair. For better security it’s
recommended to use other authentication options instead.
Session authentication requires a session ID and a CSRF token, which can be obtained after
logging in via the /api/auth/login endpoint using the basic authentication credentials.
Legacy token authentication (deprecated) requires an API key, which can be obtained
after logging in via the /api/auth/login endpoint using the basic authentication credentials.
Authentication credentials for an ApiClient instance can be specified in a Configuration object:
Session authentication and token authentication tokens can be received by logging in
using the ApiClient.auth_api.create_login() function. Then, the authentication keys
can be set in the ApiClient instance.
fromcvat_sdk.api_clientimportmodels(auth,_)=api_client.auth_api.create_login(models.LoginSerializerExRequest(username="username",password="password"))# Set up required headersassert"sessionid"inapi_client.cookies# managed by ApiClient automaticallyapi_client.set_default_header("X-CSRFToken",api_client.cookies["csrftoken"].value)api_client.set_default_header("Origin",api_client.build_origin_header())
Warning
This authentication option is deprecated and will be removed in future.
For each operation, the API wrapper class has a corresponding <operation>_endpoint member.
This member represents the endpoint as a first-class object, which provides metainformation
about the endpoint, such as the relative URL of the endpoint, parameter names,
types and their placement in the request. It also allows to pass the operation to other
functions and invoke it from there.
For a typical server entity like Task, Project, Job etc., the *Api classes provide methods
that reflect Create-Read-Update-Delete (CRUD) operations: create, retrieve, list, update,
partial_update, delete. The set of available operations depends on the entity type.
You can find the list of the available APIs and their documentation here.
Models
Requests and responses can include data. It can be represented as plain Python
data structures and model classes (or models). In CVAT API, model for requests and responses
are separated: the request models have the Request suffix in the name, while the response
models have no suffix. Models can be found in the cvat_sdk.api_client.models package.
Model parameters can be passed as models, or as plain Python data structures. This rule applies
recursively, starting from the method parameters. In particular, this means you can pass
a dict into a method or into a model constructor, and corresponding fields will
be parsed from this data automatically:
Most models provide corresponding interface classes called like I<model name>. They can be
used to implement your own classes or describe APIs. They just provide type annotations
and descriptions for model fields.
You can export model values to plain Python dicts using the to_dict() method and
the cvat_sdk.api_client.model_utils.to_json() function.
You can find the list of the available models and their documentation here.
Sending requests
To send a request to a server endpoint, you need to obtain an instance of the corresponding *Api
class. You can find summary about available API classes and supported endpoints
here. The *Api instance object allows to send requests to the relevant
server endpoints.
By default, all operations return 2 objects: the parsed response data and the response itself.
The first returned value is a model parsed from the response data. If a method does
not have any return value, None is always returned as the first value. You can control
automatic parsing using the _parse_response method kwarg. When disabled, None is returned.
The second value is the raw response, which can be useful to get response parameters, such as
status code, headers, or raw response data. By default, the status code of the response is
checked to be positive. In the case of request failure, an exception is raised by default.
This behavior can be controlled by the _check_status method kwarg. If the status is not
checked, you will need to manually check the response status code and perform actions needed.
A typical endpoint call looks like this:
fromcvat_sdk.api_clientimportApiClient,apiswithApiClient(...)asapi_client:...(data,response)=api_client.tasks_api.list()# process the response ...
Operation parameters can be passed as positional or keyword arguments. API methods provide
extra common arguments which control invocation logic:
_parse_response (bool) - Allows to enable and disable response data parsing. When enabled,
the response data is parsed into a model or a basic type and returned as the first value.
When disabled, the response is not parsed, and None is returned. Can be useful,
for instance, if you need to parse data manually, or if you expect an error in the response.
Default is True.
_check_status (bool) - Allows to enable or disable response status checks. When enabled, the
response status code is checked to be positive as defined in the HTTP standards.
In the case of negative status, an exception is raised. Default is True.
_validate_inputs (bool): specifies if type checking should be done on the data
sent to the server. Default is True.
_validate_outputs (bool): specifies if type checking should be done on the data
received from the server. Default is True.
_request_timeout (None | int | float | Tuple[int | float, int | float]) -
Allows to control timeouts. If one number is provided, it will be the total request timeout. It can also
be a tuple with (connection, read) timeouts. Default is None, which means no timeout.
_content_type (None | str) - Allows to specify the Content-Type header value
for the request. Endpoints can support different content types and behave differently
depending on the value. For file uploads _content_type="multipart/form-data" must be specified.
Read more about file uploads here. Default is application/json.
Note
The API is autogenerated. In some cases the server API schema may be incomplete
or underspecified. Please report to us all the problems found. A typical problem is that a
response data can’t be parsed automatically due to the incorrect schema. In this case, the
simplest workaround is to disable response parsing using the _parse_response=False
method argument.
You can find many examples of API client usage in REST API tests here.
Organizations
To create resource in the context of an organization, use one of these method arguments:
There are several endpoints that allow to request multiple server entities. Typically, these
endpoints are called list_.... When there are lots of data, the responses can be paginated to
reduce server load. If an endpoint returns paginated data, a single page is returned per request.
In some cases all entries need to be retrieved. CVAT doesn’t provide specific API or parameters
for this, so the solution is to write a loop to collect and join data from multiple requests.
SDK provides an utility function for this at cvat_sdk.core.helpers.get_paginated_collection().
At the moment, sending and receiving binary data - such as files - can be difficult via the
low-level SDK API. Please use the following recommendations.
Sending data
By default, requests use the application/json content type, which is a text type.
However, it’s inefficient to send binary data in this encoding, and the data passed
won’t be converted automatically. If you need to send files or other binary data,
please specify _content_type="multipart/form-data" in the request parameters:
Please also note that if there are complex fields in the data (such as nested lists or dicts),
they, in turn, cannot be encoded as multipart/form-data, so the recommended solution is to
split fields into files and others, and send them in different requests with different content
types:
Example:
data={'client_files':[...],# a list of binary files'image_quality':...,# a simple type - int'job_file_mapping':[...],# a complex type - list}# Initialize uploadingapi_client.tasks_api.create_data(id=42,data_request=models.DataRequest(image_quality=data["image_quality"]),upload_start=True,)# Upload binary dataapi_client.tasks_api.create_data(id=42,data_request=models.DataRequest(client_files=data.pop("client_files"),image_quality=data["image_quality"],),upload_multiple=True,_content_type="multipart/form-data",)# Finalize the uploading and send the remaining fieldsapi_client.tasks_api.create_data(id=42,data_request=models.DataRequest(**data),upload_finish=True,)
Receiving data
Receiving binary files can also be difficult with the low-level API. To avoid unexpected
behavior, it is recommended to specify _parse_response=False in the request parameters.
In this case, SDK will not try to parse models from responses, and the response data
can be fetched directly from the response:
importjsonfromhttpimportHTTPStatusfromtimeimportsleepfromurllib.parseimportparse_qsl,urlparsefromcvat_sdk.api_clientimportApiClient,Configuration,modelsinterval=1withApiClient(configuration=Configuration(host="<cvat_host>",username="<username>",password="<password>"))asapi_client:# Initiate the process to export a task as a dataset(_,response)=api_client.tasks_api.create_dataset_export(id=task_id,format="COCO 1.0",save_images=True,_parse_response=False,)assertresponse.status==HTTPStatus.ACCEPTED# Obtain the background request ID from the server responserq_id=json.loads(response.data).get("rq_id")assertrq_id,"The rq_id parameter was not found in the server response"# Check the status of the background processwhileTrue:(background_request,response)=api_client.requests_api.retrieve(rq_id)assertresponse.status==HTTPStatus.OKprocess_status=background_request.status.valueifprocess_statusin(models.RequestStatus.allowed_values[("value",)]["FINISHED"],models.RequestStatus.allowed_values[("value",)]["FAILED"],):breaksleep(interval)ifprocess_status!=models.RequestStatus.allowed_values[("value",)]["FINISHED"]:exception_msg=f"Export failed with status: {process_status}"ifbackground_request.message:exception_msg+=f". Details: {background_request.message}"assertFalse,exception_msg# Download a prepared fileresult_url=background_request.result_urlassertresult_url,"No 'result_url' in the server response"parsed_result_url=urlparse(result_url)query_params=parse_qsl(parsed_result_url.query)_,response=api_client.call_api(parsed_result_url.path,method="GET",query_params=query_params,auth_settings=api_client.configuration.auth_settings(),_parse_response=False,)# Save the resulting filewithopen("output_file.zip","wb")asoutput_file:while(chunk:=response.read(8192)):output_file.write(chunk)
Different versions of API endpoints
The cloudstorages/id/content REST API endpoint
Warning
The retrieve_content method of cloudstorages_api will be deprecated in 2.5.0 version.
We recommend using retrieve_content_v2 method that matches to revised API when using SDK.
For backward compatibility, we continue to support the prior interface version until version 2.6.0 is released.
Here you can find the example how to get the bucket content using new method retrieve_content_v2.
frompprintimportpprintfromcvat_sdk.api_clientimportApiClient,Configurationnext_token=Nonefiles,prefixes=[],[]prefix=""withApiClient(configuration=Configuration(host=BASE_URL,username=user,password=password))asapi_client:whileTrue:data,response=api_client.cloudstorages_api.retrieve_content_v2(cloud_storage_id,**({"prefix":prefix}ifprefixelse{}),**({"next_token":next_token}ifnext_tokenelse{}),)# the data will have the following structure:# {'content': [# {'mime_type': <image|video|archive|pdf|DIR>, 'name': <name>, 'type': <REG|DIR>},# ],# 'next': <next_token_string|None>}files.extend([prefix+f["name"]forfindata["content"]ifstr(f["type"])=="REG"])prefixes.extend([prefix+f["name"]forfindata["content"]ifstr(f["type"])=="DIR"])next_token=data["next"]ifnext_token:continueifnotlen(prefixes):breakprefix=f"{prefixes.pop()}/"pprint(files)# ['sub/image_1.jpg', 'image_2.jpg']
Sending custom requests
Sometimes you might need sending a custom request while using the ApiClient.
Typically, it’s desirable to make this request using the same configuration
and authentication parameters as regular requests sent via the ApiClient instance.
One particularly useful example for this is dataset export. When exporting a dataset,
you receive a download URL from the server after the file is prepared
(see example in receiving data). This URL requires authentication,
but it can’t be made via the regular ApiClient endpoint methods.
There are several options to make such a custom request via an ApiClient instance:
use api_client.call_api()
use api_client.request()
Alternatively, it’s also possible to make a request using a custom backend for requests, while
keeping the existing authentication of the ApiClient.
This option provides higher-level interface and allows better integration with other
ApiClient-related interfaces, such as Endpoint.
fromurllib.parseimportparse_qsl,urlparsewithApiClient(...)asapi_client:parsed_url=urlparse("<custom URL>")query_params=parse_qsl(parsed_url.query)_,response=api_client.call_api(parsed_url.path,method="GET",query_params=query_params,_parse_response=False,)# process response.data ...
This option provides a low-level interface and allows more customization. It can be useful
if you need to reuse the existing connection configuration of the ApiClient
instance, such as connection pool, timeouts, etc. In order to keep the existing
authentication parameters of the ApiClient instance, you
can use the functions api_client.get_common_headers() and api_client.update_params_for_auth().
withApiClient(...)asapi_client:headers=api_client.get_common_headers()api_client.update_params_for_auth(headers=headers,queries=[],method="GET")response=api_client.request("GET","<custom URL>",headers=headers,_parse_response=False,)# process response.data ...
It is possible make a custom request using your own backend - for example, using the requests
library. In order to keep the existing authentication parameters of the ApiClient instance, you
can use the functions api_client.get_common_headers() and api_client.update_params_for_auth().
importrequestswithApiClient(...)asapi_client:headers=api_client.get_common_headers()query_params=[]api_client.update_params_for_auth(headers=headers,queries=query_params,method="GET")response=requests.get("<custom URL>",params=query_params,headers=headers)# process the response ...
2.3 - High-level API
Overview
This layer provides high-level APIs, allowing easier access to server operations.
API includes Repositories and Entities. Repositories provide management
operations for Entities. Entities represent objects on the server
(e.g. projects, tasks, jobs etc) and simplify interaction with them. The key difference
from the low-level API is that operations on this layer are not limited by a single
server request per operation and encapsulate low-level request machinery behind a high-level
object-oriented API.
The code of this component is located in the cvat_sdk.core package.
Example
fromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.tasksimportResourceType,Task# Create a Client instance bound to a local server and authenticate using basic authwithmake_client("http://localhost",credentials=('user','password'))asclient:# Let's create a new task.# Fill in task parameters first.# Models are used the same way as in the layer 1.task_spec={"name":"example task","labels":[{"name":"car","color":"#ff00ff","attributes":[{"name":"a","mutable":True,"input_type":"number","default_value":"5","values":["4","5","6"],}],}],}# Now we can create a task using a task repository method.# Repositories can be accessed as the Client class members.# In this case we use 2 local images as the task data.task=client.tasks.create_from_data(spec=task_spec,resource_type=ResourceType.LOCAL,resources=['image1.jpg','image2.png'],)# The returned task object is already up-to-date with its server counterpart.# Now we can access task fields. The fields are read-only and can be optional.# Let's check that we have 2 images in the task data.asserttask.size==2# If an object is modified on the server, the local object is not updated automatically.# To reflect the latest changes, the local object needs to be fetch()-ed.task.fetch()# Let's obtain another task. Again, it can be done via the task repository.# Suppose we have already created the task earlier and know the task id.task2=client.tasks.retrieve(42)# The task object fields can be update()-d. Note that the set of fields that can be# modified can be different from what is available for reading.task2.update({'name':'my task'})# And the task can also be remove()-d from the server. The local copy will remain# untouched.task2.remove()
Client
The cvat_sdk.core.client.Client class provides session management, implements
authentication operations and simplifies access to server APIs.
It is the starting point for using CVAT SDK.
A Client instance allows you to:
configure connection options with the Config class
check server API compatibility with the current SDK version
manage user session with the login(), logout() and other methods
obtain high-level server object wrappers with the users, tasks, jobs and other members
reach lower-level APIs to send raw requests, typically via the api member of the object
An instance of Client can be created directly by calling the class constructor
or with the utility function cvat_sdk.core.client.make_client() which can handle
some configuration for you. A Client can be configured with
the cvat_sdk.core.client.Config class instance. A Config object can be passed to
the Client constructor and then it will be available in the Client.config field.
The Client class implements the context manager protocol.
When the context is closed, the session is finished, and the user is logged out
automatically. Otherwise, these actions can be done with the close() and logout() methods.
You can create and start using a Client instance this way:
The make_client() function handles configuration and object creation for you.
It also allows to authenticate right after the object is created.
If you need to configure Client parameters, you can do this:
fromcvat_sdkimportConfig,Clientconfig=Config()# set up some config fields ...withClient("https://app.cvat.ai",config=config)asclient:client.login(("user","password"))...
Note
Historically, the SDK has allowed the URL scheme (http: or https:)
to be omitted, and would attempt to automatically detect the protocol.
This automatic detection has been removed due to being inherently insecure.
Now, if the scheme is omitted, the SDK assumes https:.
For clarity, it is recommended to always specify the scheme explicitly.
When the server is located, its version is checked. If an unsupported version is found,
an error can be raised or suppressed (controlled by config.allow_unsupported_server).
If the error is suppressed, some SDK functions may not work as expected with this server.
By default, a warning is raised and the error is suppressed.
Authentication
High-level SDK supports 2 authentication options:
Personal Access Token (PAT) authentication, with an access token value
Password authentication, with a username and a password
Personal Access Token (PAT) authentication requires a token that can be configured
in the user settings section in the UI. It is the recommended authentication option
for most API clients. Read more.
Password authentication requires a username and password pair. For better security it’s
recommended to use a Personal Access Token (PAT) instead, if possible.
With the make_client() function, the Client object create will perform authentication
automatically for you. If you want more fine-grained control over the requests,
there are several methods available:
client.login() - logs the user in using the specified credentials
client.logout() - logs the user out
client.has_credentials() - allows to check whether the client object is authenticated
If the Client is used as a context manager (with the with keyword), it automatically calls
logout() before exiting.
Persistent authentication (profiles)
The SDK ships an on-disk store that lets scripts and pipelines reuse a saved
server URL and Personal Access Token (PAT) without re-entering credentials.
The store is the same file the CVAT CLI uses
(see the CLI docs
for the exact path and permission requirements): profiles created from the
CLI are visible to the SDK and vice-versa.
Building a Client from a profile
fromcvat_sdkimportAuthStore,make_client_from_profile_,profile=AuthStore().get_default_profile()withmake_client_from_profile(profile)asclient:...# already logged in with the profile's PAT
make_client_from_cli applies the same host/credential resolution order as
cvat-cli - useful when writing SDK-based scripts that should honor the same
--profile / --server-host / --auth / CVAT_ACCESS_TOKEN conventions:
importargparsefromcvat_sdkimportmake_client_from_clifromcvat_sdk.core.authimportconfigure_client_auth_argumentsparser=argparse.ArgumentParser()configure_client_auth_arguments(parser)# registers the shared auth flagsparser.add_argument("--task-id",type=int,required=True)args=parser.parse_args()withmake_client_from_cli(args)asclient:task=client.tasks.retrieve(args.task_id)print(task.name)
configure_client_auth_arguments adds the exact same flag spellings the CLI
uses (--profile, --server-host, --server-port, --auth, --insecure,
--organization) so downstream scripts stay drop-in compatible with the CLI’s
authentication conventions.
Public API summary
cvat_sdk.AuthStore - reads and writes the on-disk auth.json, enforces
0600/0700 permissions, provides CRUD for profiles, the default profile,
and the default server URL.
cvat_sdk.ProfileEntry - immutable value class (server, token,
created_date) representing one saved profile.
cvat_sdk.get_auth_store_path() - the path to the store on the current
platform.
cvat_sdk.make_client_from_profile(profile, *, logger=None, config=None, check_server_version=False) - construct and authenticate a Client from a
ProfileEntry.
cvat_sdk.make_client_from_cli(parsed_args, *, logger=None, store=None) -
construct and authenticate a Client from an argparse Namespace
(typically produced by configure_client_auth_arguments) using the CLI’s
full resolution order.
cvat_sdk.core.auth.configure_client_auth_arguments(parser) - register the
shared auth flags on an argparse.ArgumentParser.
Users and organizations
All Client operations rely on the server API and depend on the current user
rights. This affects the set of available APIs, objects and actions. For example, a regular user
can only see and modify their tasks and jobs, while an admin user can see all the tasks etc.
Operations are also affected by the current organization context,
which can be set with the organization_slug property of Client instances.
The organization context affects which entities are visible,
and where new entities are created.
Set organization_slug to an organization’s slug (short name)
to make subsequent operations work in the context of that organization:
client.organization_slug='myorg'# create a task in the organizationtask=client.tasks.create_from_data(...)
You can also set organization_slug to an empty string
to work in the context of the user’s personal workspace.
By default, it is set to None,
which means that both personal and organizational entities are visible,
while new entities are created in the personal workspace.
To temporarily set the organization slug, use the organization_context function:
withclient.organization_context('myorg'):task=client.tasks.create_from_data(...)# the slug is now reset to its previous value
Entities and Repositories
Entities represent objects on the server. They provide read access to object fields
and implement additional relevant operations, including both the general Read-Update-Delete and
object-specific ones. The set of available general operations depends on the object type.
Repositories provide management operations for corresponding Entities. You don’t
need to create Repository objects manually. To obtain a Repository object, use the
corresponding Client instance member:
After calling these functions, we obtain local objects representing their server counterparts.
The list() method accepts the same filtering, search, and ordering query parameters supported
by the corresponding server endpoint. Simple equality filters can be passed directly:
For richer conditions, compose expressions with the cvat_sdk.core.filters helpers instead of
hand-writing JSON Logic:
fromcvat_sdk.core.filtersimportF# completed tasks in projects 1, 2, or 3tasks=client.tasks.list(filter=(F.status=="completed")&F.project_id.one_of([1,2,3]))
See Filtering lists for the full set of operators, keyword lookups, and
how multiple conditions are combined.
Object fields can be updated with the update() method. Note that the set of fields that can be
modified can be different from what is available for reading.
job.update({'stage':'validation'})
The server object will be updated and the local object will reflect the latest object state
after calling this operation.
Note that local objects may fall out of sync with their server counterparts for different reasons.
If you need to update the local object with the latest server state, use the fetch() method:
# obtain 2 local copies of the same jobjob_ref1=client.jobs.retrieve(1)job_ref2=client.jobs.retrieve(1)# update the server object with the first referencejob_ref1.update(...)# job_ref2 is outdated nowjob_ref2.fetch()# job_ref2 is synced
Finally, if you need to remove the object from the server, you can use the remove() method.
The server object will be removed, but the local copy of the object will remain untouched.
task=client.tasks.retrieve(<taskid>)task.remove()
Repositories can also provide group operations over entities. For instance, you can retrieve
all available objects using the list() Repository method. The list of available
Entity and Repository operations depends on the object type.
You can learn more about entity members and how model parameters are passed to functions here.
The implementation for these components is located in cvat_sdk.core.proxies.
Filtering lists
Every Repository list() method accepts the same filtering, search, and ordering query
parameters as the corresponding server endpoint. There are four ways to express a filter,
from the simplest to the most powerful.
Simple equality filters
Pass field values directly as keyword arguments. They are sent to the server as-is:
For richer conditions, build expressions with the F object from cvat_sdk.core.filters
instead of hand-writing JSON Logic. Field expressions combine with & (and), | (or) and
~ (not). Wrap each comparison in parentheses, because Python binds &/| tighter than
comparison operators:
fromcvat_sdk.core.filtersimportF# completed tasks in projects 1, 2, or 3tasks=client.tasks.list(filter=(F.status=="completed")&F.project_id.one_of([1,2,3]))# tasks named like "demo" OR with no assigneetasks=client.tasks.list(filter=F.name.contains("demo")|~F.assignee.is_set())
The available field helpers are:
Helper
Meaning
F.field == value
equals
F.field != value
not equals
F.field < / <= / > / >= value
ordering comparisons
F.field.one_of([...])
value is in the given list
F.field.contains(substring)
substring/membership match
F.field.between(low, high)
value is within the inclusive range
F.field.is_set()
field has a (non-null) value
Use F["weird-name"] (item access) for field names that aren’t valid Python identifiers.
Keyword lookups
For simple AND-only filters you can skip the F object and use keyword lookups, where the
operator is a suffix on the keyword name:
The supported suffixes are __in, __contains, __lt, __lte, __gt, __gte, __ne,
__between, and __isset. Multiple lookups in the same call are combined with and.
Combining and raw forms
Keyword lookups and a filter= expression provided in the same call are combined with and,
so you can mix the two styles freely:
# (name contains "demo") AND (id >= 10)tasks=client.tasks.list(filter=F.name.contains("demo"),id__gte=10)
If you already have JSON Logic, the raw form is still accepted — pass either a dict or a
JSON string to filter=:
This layer provides functionality
that enables you to treat CVAT projects and tasks as PyTorch datasets.
The code of this layer is located in the cvat_sdk.pytorch package.
To use it, you must install the cvat_sdk distribution with the pytorch extra.
Example
importtorchimporttorchvision.modelsfromcvat_sdkimportmake_clientfromcvat_sdk.pytorchimportProjectVisionDataset,ExtractSingleLabelIndex# create a PyTorch modelmodel=torchvision.models.resnet34(weights=torchvision.models.ResNet34_Weights.IMAGENET1K_V1)model.eval()# log into the CVAT serverwithmake_client("http://localhost",credentials=('user','password'))asclient:# get the dataset comprising all tasks for the Validation subset of project 12345dataset=ProjectVisionDataset(client,project_id=12345,include_subsets=['Validation'],# use transforms that fit our neural networktransform=torchvision.models.ResNet34_Weights.IMAGENET1K_V1.transforms(),target_transform=ExtractSingleLabelIndex())# print the number of images in the dataset (in other words, the number of frames# in the included tasks)print(len(dataset))# get a sample from the datasetimage,target=dataset[0]# evaluate the network on the sample and compare the output to the targetoutput=model(image)iftorch.equal(output,target):print("correct prediction")else:print("incorrect prediction")
Datasets
The key components of this layer are the dataset classes,
ProjectVisionDataset and TaskVisionDataset,
representing data & annotations contained in a CVAT project or task, respectively.
Both of them are subclasses of the torch.utils.data.Dataset abstract class.
The interface of Dataset is essentially that of a sequence
whose elements are samples from the dataset.
In the case of TaskVisionDataset, each sample represents a frame from the task
and its associated annotations.
The order of the samples is the same as the order of frames in the task.
Deleted frames are omitted.
In the case of ProjectVisionDataset,
each sample is a sample from one of the project’s tasks,
as if obtained from a TaskVisionDataset instance created for that task.
The full sequence of samples is built by concatenating the sequences of samples
from all included tasks in an unspecified order
that is guaranteed to be consistent between executions.
For details on what tasks are included, see Task filtering.
Construction
Both dataset classes are instantiated by passing in an instance of cvat_sdk.Client
and the ID of the project or task:
During construction,
the dataset objects either populate or validate the local data cache
(see Caching for details).
Any necessary requests to the CVAT server are performed at this time.
After construction, the objects make no more network requests.
Sample format
Indexing a dataset produces a sample.
A sample has the form of a tuple with the following components:
target.image_size (tuple[int, int]):
the image size as a (width, height) tuple.
Note that track annotations are currently inaccessible.
Transform support
The dataset classes support torchvision-like transforms
that you can supply to preprocess each sample before it’s returned.
You can use this to convert the samples to a more convenient format
or to preprocess the data.
The transforms are supplied via the following constructor parameters:
transforms: a callable that accepts two arguments (the image and the target)
and returns a tuple with two elements.
transform: a callable that accepts an image.
target_transform: a callable that accepts a target.
Let the sample value prior to any transformations be (image, target).
Here is what indexing the dataset will return for various combinations of
supplied transforms:
transform and target_transform:
(transform(image), target_transform(target)).
transforms cannot be supplied at the same time
as either transform or target_transform.
The cvat_sdk.pytorch module contains some target transform classes
that are intended for common use cases.
See Transforms.
Label index assignment
The annotation model classes (LabeledImage and LabeledShape)
reference labels by their IDs on the CVAT server.
This is usually not very useful for machine learning code,
since those IDs are unpredictable and will be different between different projects,
even if semantically the set of labels is the same.
Therefore, the dataset classes assign to each label a unique index that
is intended to be a project-independent identifier.
These indices are accessible via the label_id_to_index attribute
on each sample’s target.
This attribute maps IDs on the server to the assigned index.
The mapping is the same for every sample.
By default, the dataset classes arrange all label IDs in an unspecified order
that remains consistent across executions,
and assign them sequential indices, starting with 0.
You can override this behavior and specify your own label indices
with the label_name_to_index constructor parameter.
This parameter accepts a mapping from label name to index.
The mapping must contain a key for each label in the project/task.
When this parameter is specified, label indices are assigned
by looking up each label’s name in the provided mapping and using the result.
Task filtering
Note: this section applies only to ProjectVisionDataset.
By default, a ProjectVisionDataset includes samples
from every task belonging to the project.
You can change this using the following constructor parameters:
task_filter (Callable[[models.ITaskRead], bool]):
if set, the callable will be called for every task,
with an instance of ITaskRead corresponding to that task
passed as the argument.
Only tasks for which True is returned will be included.
include_subsets (Container[str]):
if set, only tasks whose subset is a member of the container
will be included.
Both parameters can be set,
in which case tasks must fulfill both criteria to be included.
Caching
The images and annotations of a dataset can be substantial in size,
so they are not downloaded from the server every time a dataset object is created.
Instead, they are loaded from a cache on the local file system,
which is maintained during dataset object construction
according to the policy set by the update_policy constructor parameter.
The available policies are:
UpdatePolicy.IF_MISSING_OR_STALE:
If some data is already cached,
query the server to determine if it is out of date.
If so, discard it.
Then, download all necessary data that is missing from the cache and cache it.
This is the default policy.
UpdatePolicy.NEVER:
If some necessary data is missing from the cache,
raise an exception.
Don’t make any network requests.
Note that this policy permits the use of stale data.
By default, the cache is located in a platform-specific per-user directory.
You can change this location with the cache_dir setting in the Client configuration.
Transforms
The layer provides some classes whose instances are callables
suitable for usage with the target_transform dataset constructor parameter
that are intended to simplify working with CVAT datasets in common scenarios.
ExtractBoundingBoxes
Intended for object detection tasks.
Constructor parameters:
include_shape_types (Iterable[str]).
The values must be from the following list:
"ellipse"
"points"
"polygon"
"polyline"
"rectangle"
Effect: Gathers all shape annotations from the input target object
whose types are contained in the value of include_shape_types.
Then returns a dictionary with the following string keys
(where N is the number of gathered shapes):
"boxes" (a floating-point tensor of shape Nx4).
Each row represents the bounding box the corresponding shape
in the following format: [x_min, y_min, x_max, y_max].
"labels" (an integer tensor of shape N).
Each element is the index of the label of the corresponding shape.
include_shape_types (Iterable[str]).
The values must be from the following list:
"mask"
"polygon"
Effect: Gathers all shape annotations from the input target object
whose types are contained in the value of include_shape_types.
Then returns a dictionary with the following string keys
(where N is the number of gathered shapes,
and H and W are the image height and width):
"boxes" (a floating-point tensor of shape Nx4).
Each row represents the bounding box of the corresponding shape
in the following format: [x_min, y_min, x_max, y_max].
"labels" (an integer tensor of shape N).
Each element is the index of the label of the corresponding shape.
"masks" (an unsigned 8-bit integer tensor of shape NxHxW).
Each element is a binary instance mask for the corresponding shape.
CVAT mask annotations are decoded from their encoded points representation.
Effect: If the input target object contains no tag annotations
or more than one tag annotation, raises ValueError.
Otherwise, returns the index of the label in the solitary tag annotation
as a zero-dimensional tensor.
Example:
ExtractSingleLabelIndex()
2.5 - Auto-annotation API
Overview
This layer provides functionality
that allows you to automate the process of annotating a CVAT dataset
by delegating this process (or parts of it) to a program running on a machine under your control.
To make use of this delegation, you must implement an “auto-annotation function”,
or “AA function” for short.
This is a Python object that implements one of the protocols defined by this layer.
The particular protocol implemented defines
which part of the annotation process the AA function will be able to automate.
An AA function may be used in one of the following modes:
Immediate mode.
This involves annotating a specific CVAT task by passing the AA function to a driver,
along with the identifier of the task and optional additional parameters.
This may be done either:
via the CVAT CLI (consult the description of the task auto-annotate command
in the CLI documentation).
Agent mode.
This involves registering the AA function with the CVAT server
(creating a resource on the server known as a “native function”)
and then running one or more agent processes.
This makes the AA function usable from the CVAT UI.
CVAT users can choose to use the native function as the model when using CVAT’s AI tools.
When they do, the agents detect this, and process their requests by calling appropriate
methods on the corresponding AA function.
Consult AI models
for information on how to use each function kind from the CVAT UI.
Depending on how you create the native function, it’ll be accessible to only you,
your organization, or every user of the CVAT instance.
For more details, consult the descriptions of the function create-native
and function run-agent commands in the CLI documentation.
This SDK layer can be divided into several parts:
The interface, containing the protocols that an AA function must implement,
as well as helpers for use by such functions.
Consult Auto-annotation interface.
The driver, containing functionality to annotate a CVAT dataset using an AA function.
Consult Auto-annotation driver.
While not part of the SDK,
there are also additional predefined AA functions in the CVAT source repository.
Consult Additional AA functions.
Example
An AA function may be implemented in any way that is appropriate for your use case.
However, a typical AA function will be based on a machine learning model
and consist of the following basic elements:
Code to load the ML model.
A specification defining which protocol the AA function implements,
as well as static properties of the AA function
(such as a description of the annotations that the AA function can produce).
Code to convert data from SDK data structures to a format the ML model can understand.
Code to run the ML model.
Code to convert resulting annotations to SDK data structures.
The following code snippet shows an example AA function implementation
(specifically, a detection function),
as well as code that creates an instance of the function and uses it for auto-annotation.
fromtypingimportListimportPIL.Imageimporttorchvision.modelsfromcvat_sdkimportmake_clientimportcvat_sdk.modelsasmodelsimportcvat_sdk.auto_annotationascvataaclassTorchvisionDetectionFunction:def__init__(self,model_name:str,weights_name:str,**kwargs)->None:# load the ML modelweights_enum=torchvision.models.get_model_weights(model_name)self._weights=weights_enum[weights_name]self._transforms=self._weights.transforms()self._model=torchvision.models.get_model(model_name,weights=self._weights,**kwargs)self._model.eval()@propertydefspec(self)->cvataa.DetectionFunctionSpec:# describe the annotationsreturncvataa.DetectionFunctionSpec(labels=[cvataa.label_spec(cat,i,type="rectangle")fori,catinenumerate(self._weights.meta["categories"])ifcat!="N/A"])defdetect(self,context:cvataa.DetectionFunctionContext,image:PIL.Image.Image)->list[models.LabeledShapeRequest]:# determine the threshold for filtering resultsconf_threshold=context.conf_thresholdor0# convert the input into a form the model can understandtransformed_image=[self._transforms(image)]# run the ML modelresults=self._model(transformed_image)# convert the results into the form SDK requiresreturn[cvataa.rectangle(label.item(),[x.item()forxinbox])forresultinresultsforbox,label,scoreinzip(result["boxes"],result["labels"],result["scores"])ifscore>=conf_threshold]# log into the CVAT serverwithmake_client("http://localhost",credentials=("user","password"))asclient:# create a function that uses Faster R-CNNfunc=TorchvisionDetectionFunction("fasterrcnn_resnet50_fpn_v2","DEFAULT",box_score_thresh=0.5)# annotate task 12345 using the functioncvataa.annotate_task(client,12345,func)
Auto-annotation interface
This part of the auto-annotation layer defines the protocols that an AA function must implement.
Detection function protocol
A detection function is a type of AA function
that accepts an image and returns a list of shapes found in that image.
A detection function can be used in either agent or immediate mode.
A detection function must have two attributes, spec and detect.
spec must contain the AA function’s specification,
which is an instance of DetectionFunctionSpec.
DetectionFunctionSpec must be initialized with a sequence of PatchedLabelRequest objects
that represent the labels that the AA function knows about.
See the docstring of DetectionFunctionSpec for more information on the constraints
that these objects must follow.
BadFunctionError will be raised if any constraint violations are detected.
detect must be a function/method accepting two parameters:
context (DetectionFunctionContext).
Contains invocation parameters and information about the current image.
The following fields are available:
frame_name (str). The file name of the frame on the CVAT server.
conf_threshold (float | None). The confidence threshold that the function
should use to filter objects. If None, the function may apply a default
threshold at its discretion.
image (PIL.Image.Image).
Contains image data.
detect must return a sequence of LabeledImageRequest and/or LabeledShapeRequest objects,
representing tags/shapes found in the image.
See the docstring of DetectionFunctionSpec for more information on the constraints
that these objects must follow.
The same AA function may be used with any dataset that contain labels with the same name
as the AA function’s specification.
The way it works is that the driver matches labels between the spec and the dataset,
and replaces the label IDs in the tag & shape objects with those defined in the dataset.
For example, suppose the AA function’s spec defines the following labels:
Name
ID
bat
0
rat
1
And the dataset defines the following labels:
Name
ID
bat
100
cat
101
rat
102
Then suppose detect returns a shape with label_id equal to 1.
The driver will see that it refers to the rat label, and replace it with 102,
since that’s the ID this label has in the dataset.
The same logic is used for sublabel and attribute IDs.
Helper factory functions
The CVAT API model types used in the detection function protocol are somewhat unwieldy to work with,
so it’s recommended to use the helper factory functions provided by this layer.
These helpers instantiate an object of their corresponding model type,
passing their arguments to the model constructor
and sometimes setting some attributes to fixed values.
The following helpers are available for building specifications:
Name
Model type
Fixed attributes
label_spec
PatchedLabelRequest
-
skeleton_label_spec
PatchedLabelRequest
type="skeleton"
keypoint_spec
SublabelRequest
type="points"
attribute_spec
AttributeRequest
mutable=False
checkbox_attribute_spec
AttributeRequest
mutable=False, input_type="checkbox", values=[]
number_attribute_spec
AttributeRequest
mutable=False, input_type="number"
radio_attribute_spec
AttributeRequest
mutable=False, input_type="radio"
select_attribute_spec
AttributeRequest
mutable=False, input_type="select"
text_attribute_spec
AttributeRequest
mutable=False, input_type="number", values=[]
For number_attribute_spec,
it’s recommended to use the cvat_sdk.attributes.number_attribute_values function
to create the values argument, since this function will enforce the constraints expected
for attribute specs of this type.
For example:
The following helpers are available for use in detect:
Name
Model type
Fixed attributes
tag
LabeledImageRequest
frame=0
shape
LabeledShapeRequest
frame=0
mask
LabeledShapeRequest
frame=0, type="mask"
polygon
LabeledShapeRequest
frame=0, type="polygon"
rectangle
LabeledShapeRequest
frame=0, type="rectangle"
skeleton
LabeledShapeRequest
frame=0, type="skeleton"
keypoint
SubLabeledShapeRequest
frame=0, type="points"
For mask, it is recommended to create the points list using
the cvat_sdk.masks.encode_mask function, which will convert a bitmap into a
list in the format that CVAT expects. For example:
cvataa.mask(my_label,encode_mask(my_mask,# boolean 2D array, same size as the input image[x1,y1,x2,y2],# top left and bottom right coordinates of the mask))
To create shapes with attributes,
it’s recommended to use the cvat_sdk.attributes.attribute_vals_from_dict function,
which returns a list of objects that can be passed to an attributes argument:
An interaction function is a type of AA function that accepts an image
and a set of prompts describing an object (or objects) in that image,
and returns the shapes of those objects.
An interaction function can only be used in agent mode.
An interaction function must have two attributes, spec and detect.
It may also optionally have a preprocess_image attribute.
spec must contain the AA function’s specification,
which is an instance of InteractionFunctionSpec.
This specification defines restrictions on prompts that the AA function will accept.
Interaction functions may support one or more of the following types of prompts:
Positive points (points located inside the object(s) of interest).
An interaction function must support this type of prompt.
You must pass a min_pos_points parameter to the InteractionFunctionSpec constructor
specifying the minimum number of positive points the user must include in the prompt
(possibly 0).
Negative points (points located outside the object(s) of interest).
Support for this type of prompt is optional.
To declare support, pass a min_neg_points parameter to the InteractionFunctionSpec constructor
specifying the minimum number of negative points the user must include in the prompt
(possibly 0).
A bounding box.
Support for this type of prompt is optional.
To declare support, pass a min_bounding_boxes parameter
to the InteractionFunctionSpec constructor
with the value of either 0 (if the bounding box prompt is optional) or 1 (if it is required).
Here is an example of a spec for an interaction function
that requires at least two positive points and an optional bounding box:
detect must be a function accepting the following parameters:
context (InteractionFunctionContext).
This is currently a dummy object and should be ignored.
In future versions, this may contain additional information.
pp_image (type varies).
A preprocessed image.
Consult the description of preprocess_image for more details.
prompts (InteractionPrompts).
The prompts describing the object(s) of interest.
This object will have fields corresponding to the possible types of prompts:
pos_points - the positive points as a sequence of (x, y) tuples.
neg_points - the negative points as a sequence of (x, y) tuples.
bounding_box - the bounding box as a pair of (x, y) tuples representing
the top-left and bottom right corners of the box.
If no bounding box prompt was passed, this will be None.
detect must detect the object(s) corresponding to the prompt
and return them as a (possibly empty) list of InteractionResultShape objects.
InteractionResultShape is a minimal version of the LabeledShape SDK model,
containing only the type, points, and attributes fields.
Note
The CVAT UI can currently only process returned shapes of type mask.
The attributes field may only contain attributes with spec_id equal to
one of the members of the InteractionResultAttributes enum.
Currently, only one such member is defined:
CONFIDENCE: the confidence level for the object as a number in the range [0, 1].
It’s recommended to use the cvat_sdk.attributes.attribute_vals_from_dict function
to create the attribute list if one is needed.
preprocess_image, if implemented, must accept the following parameters:
context (InteractionFunctionContext).
This is currently a dummy object and should be ignored.
In future versions, this may contain additional information.
image (PIL.Image.Image).
An image that objects must be detected in.
preprocess_image must perform any analysis on the image that the function can perform
independently of the prompt
and return an object representing the results of that analysis.
This object will be passed as pp_image to detect.
If preprocess_image is not implemented, then the pp_image object will be the original image.
In other words, the default implementation is:
defpreprocess_image(context,image):returnimage
Tracking function protocol
A tracking function is a type of AA function that analyzes an image with one or more shapes on it,
and then predicts the positions of those shapes on subsequent images.
A tracking function can only be used in agent mode.
Warning
Currently, only one agent should be run for each tracking function.
If multiple agents for one tracking function are run at the same time,
CVAT users may experience intermittent “Tracking state not found” errors when using the function.
A tracking function must have three attributes, spec, init_tracking_state, and track.
It may also optionally have a preprocess_image attribute.
spec must contain the AA function’s specification,
which is an instance of TrackingFunctionSpec.
This specification must be initialized with a single supported_shape_types parameter,
defining which types of shapes the AA function is able to track.
For example:
init_tracking_state must be a function accepting the following parameters:
context (TrackingFunctionShapeContext).
An object with information about the shape being tracked. See details below.
pp_image (type varies).
A preprocessed image.
Consult the description of preprocess_image for more details.
shape (TrackableShape).
A shape within the preprocessed image.
TrackableShape is a minimal version of the LabeledShape SDK model,
containing only the type and points fields.
The shape’s type is guaranteed to be one of the types listed
in the supported_shape_types field of the spec.
init_tracking_state must analyze the shape and create a state object containing
any information that the AA function will need to predict its location on a subsequent image.
It must then return this object.
init_tracking_state must not modify either pp_image or shape.
track must be a function accepting the following parameters:
context (TrackingFunctionShapeContext).
An object with information about the shape being tracked. See details below.
pp_image (type varies).
A preprocessed image.
Consult the description of preprocess_image for more details.
This image will have the same dimensions as those of the image used to create the state object.
state (type varies).
The object returned by a previous call to init_tracking_state.
track must locate the shape that was used to create the state object
on the new preprocessed image.
If it is able to do that, it must return its prediction as a new TrackableShape object.
This object must have the same value of type as the original shape.
If track is unable to locate the shape, it must return None.
track may modify state as needed to improve prediction accuracy on subsequent frames.
It must not modify pp_image.
A TrackingFunctionShapeContext object passed to both init_tracking_state and track
will have the following field:
original_shape_type (str).
The type of the shape being tracked.
In init_tracking_state, this is the same as shape.type.
In track, this is the type of the shape that state was created from.
preprocess_image, if implemented, must accept the following parameters:
context (TrackingFunctionContext).
This is currently a dummy object and should be ignored.
In future versions, this may contain additional information.
image (PIL.Image.Image).
An image that will be used to either start or continue tracking.
preprocess_image must perform any analysis on the image that the function can perform
independently of the shapes being tracked
and return an object representing the results of that analysis.
This object will be passed as pp_image to init_tracking_state and track.
If preprocess_image is not implemented, then the pp_image object will be the original image.
In other words, the default implementation is:
defpreprocess_image(context,image):returnimage
Auto-annotation driver
The annotate_task function uses a detection function to annotate a CVAT task.
It must be called as follows:
It will run the AA function for every image in the given task,
combine the resulting list of shapes and uploaded it to the task.
The supplied client will be used to make all API calls.
By default, new annotations will be appended to the old ones.
Use clear_existing=True to remove old annotations instead.
If a detection function declares a label that has no matching label in the task,
then by default, BadFunctionError is raised, and auto-annotation is aborted.
If you use allow_unmatched_label=True, then such labels will be ignored,
and any shapes referring to them will be dropped.
Same logic applies to sublabels and attributes.
It’s possible to pass a custom confidence threshold to the function via the
conf_threshold parameter.
annotate_task will raise a BadFunctionError exception
if it detects that the function violated the detection function protocol.
Predefined AA functions
This layer includes several predefined detection functions.
You can use them as-is, or as a base on which to build your own.
These AA functions use models from the
the torchvision library.
To use them, install CVAT SDK with the pytorch extra:
$ pip install "cvat-sdk[pytorch]"
Each function is implemented as a dedicated module
to allow usage via the CLI auto-annotate command.
This AA function uses torchvision’s classification models.
It produces tag annotations.
For each frame, the function will output one tag whose label has the highest probability,
as long as that probability is greater or equal to the input confidence threshold.
If it is lower, the function will output nothing.
This AA function uses torchvision’s instance segmentation models.
It produces mask or polygon annotations (depending on the value of conv_mask_to_poly).
This AA function uses torchvision’s keypoint detection models.
It produces skeleton annotations.
Keypoints which the model marks as invisible will be marked as occluded in CVAT.
Additional AA functions
The CVAT source repository contains additional predefined auto-annotation functions
that are built on top of other computer vision libraries.
The following libraries and models are currently covered:
Hugging Face Transformers: all models that are usable with the image classification,
object detection and image segmentation pipelines.
Segment Anything Model 2 (SAM2).
Ultralytics: all numbered YOLO models (YOLOv3, YOLOv5, and so on).
Complete, copy-and-run SDK scripts grouped by domain area
Every example in this section is a complete script that uses argparse.
Pass --help to any script to see all options. The same files live in
cvat-sdk/examples/.
Shared conventions:
Every recipe takes --host and --token. Create a token in the CVAT UI under
Profile -> Security. Wrap values that contain URL punctuation in single quotes,
e.g. --host 'https://app.cvat.ai'. auth_profile.py and auth_cli.py show
alternative sign-in flows.
Recipes that create resources keep them and print their ids and UI links. Pass
--cleanup to delete what the script created (never the sources it read).
Recipes that inspect or export take an existing resource id
(--project-id, --task-id), so they work directly against your data.
List-valued options accept multiple values, e.g. --labels car person.
Missing arguments exit with a friendly message; SDK errors surface as normal
Python tracebacks.
All examples are tested in the latest SDK version.
Webhooks — register and ping a webhook, receive deliveries locally
2.6.1 - Authenticate a client
Copy-and-run auth recipes: PAT (recommended), saved profiles, and the CLI-compatible argument set
Three recipes: auth_token.py is the recommended PAT path, auth_profile.py
signs in from a saved profile with no secret in your code, and auth_cli.py
wires up the shared cvat-cli argument set (--server-host, --auth,
--profile, …) so your scripts feel like an extension of the CLI.
Connect with a Personal Access Token
Opens an authenticated client with a PAT, prints the server version, and prints
who you are — a quick sanity check any script can copy.
Flag
Required
Meaning
--host
yes
Server URL, e.g. 'https://app.cvat.ai'
--token
yes
Token created in the CVAT UI (Profile -> Security)
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Connect to CVAT with a Personal Access Token (PAT) — the recommended way.
Steps:
1. Open an authenticated client.
2. Print the server version.
3. Print who you are authenticated as (a quick sanity check for scripts).
Usage (run ``python auth_token.py --help`` for the full list of options):
python auth_token.py --host 'https://app.cvat.ai' --token '<your token>'
Create a token in the CVAT UI under Profile -> Security.
"""importargparsefromcvat_sdkimportmake_clientdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (create one in the CVAT UI: Profile -> Security)",)returnparser.parse_args()defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:print("Server version:",client.get_server_version())me=client.users.retrieve_current_user()print(f"Authenticated as {me.username} (id={me.id})")if__name__=="__main__":main()
Sign in from a saved profile
Uses a saved CLI profile so no secret lives in the code. Create a profile once
with cvat-cli; then any script can pick it by name or fall back to the
default profile.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Authenticate without putting a token in your code: use a saved profile.
Create a profile once on the command line, then any script can use it:
cvat-cli --server-host 'https://app.cvat.ai' profile create --name app --set-default
Steps:
1. If --profile is passed, use that profile; otherwise use the default profile.
2. Print who you are authenticated as.
Usage (run ``python auth_profile.py --help`` for the full list of options):
python auth_profile.py --profile app
python auth_profile.py # uses the default profile
"""importargparseimportsysfromcvat_sdkimportmake_client_from_profilefromcvat_sdk.core.authimportAuthStoredefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--profile",help="name of a saved profile; omit to use the default profile")returnparser.parse_args()defmain()->None:args=parse_args()store=AuthStore()ifargs.profile:profile=store.get_profile(args.profile)ifprofileisNone:sys.exit(f"Profile {args.profile!r} not found. Create it with cvat-cli.")print(f"Using profile {args.profile!r}")else:default=store.get_default_profile()ifdefaultisNone:sys.exit("No default profile configured. Create one with:\n"" cvat-cli --server-host 'https://app.cvat.ai' profile create"" --name app --set-default")name,profile=defaultprint(f"Using default profile {name!r}")withmake_client_from_profile(profile)asclient:me=client.users.retrieve_current_user()print(f"Authenticated as {me.username} (id={me.id})")if__name__=="__main__":main()
Build a CLI-compatible script
Reuses cvat-cli’s shared auth arguments (--server-host, --server-port,
--auth, --profile, --insecure, --organization) with
configure_client_auth_arguments, then hands the parsed namespace to
make_client_from_cli, which picks the right factory (profile / PAT / password)
from the arguments. This is the go-to pattern when your script should feel like
an extension of cvat-cli.
Flag
Required
Meaning
--server-host
fallback
Server URL when not using a profile
--auth
fallback
USER:PASS (deprecated password sign-in) or USER — see cvat-cli
--profile
fallback
Named saved profile; falls back to the default profile if no host/auth
--insecure, --organization, --server-port
no
Reused from cvat-cli’s shared arg set
Also honors CVAT_ACCESS_TOKEN / CVAT_PASSWORD environment variables the same
way cvat-cli does.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Build a CLI-compatible script that reuses ``cvat-cli``'s auth argument set:
``--server-host`` / ``--server-port`` / ``--auth`` / ``--profile`` / ``--insecure`` / ``--organization``.
This is the go-to pattern when your script should feel like an extension of
``cvat-cli`` — it accepts the same flags, honors the ``CVAT_ACCESS_TOKEN`` and
``PASS`` env variables, and resolves profiles the same way (explicit
``--profile``, else the default profile if no host/auth is passed).
Steps:
1. Register the shared auth flags with ``configure_client_auth_arguments()``.
2. Add your own script-specific arguments on top.
3. Hand the parsed namespace to ``make_client_from_cli()`` to create a server API client object.
Usage (run ``python auth_cli.py --help`` for the full list of options):
python auth_cli.py --profile app
# export CVAT_ACCESS_TOKEN='<token>' # for macOS/Linux
# $env:CVAT_ACCESS_TOKEN = "<token>" # for PowerShell
python auth_cli.py --server-host 'https://app.cvat.ai'
python auth_cli.py --server-host 'https://app.cvat.ai' --auth me:secret
"""importargparsefromcvat_sdkimportmake_client_from_clifromcvat_sdk.core.authimportconfigure_client_auth_argumentsdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])configure_client_auth_arguments(parser)# Add your script's own arguments here, e.g.# parser.add_argument("--task-id", type=int, required=True)returnparser.parse_args()defmain()->None:args=parse_args()withmake_client_from_cli(args)asclient:me=client.users.retrieve_current_user()print(f"Authenticated as {me.username} (id={me.id})")if__name__=="__main__":main()
Notes:
Personal Access Tokens are the recommended path. Password sign-in (via --auth USER:PASS) is a deprecated fallback that will be removed in a future release.
Create/list, backup, restore, dataset export — one recipe per file
Five recipes cover the project lifecycle: project_create_and_list.py for the
common CRUD path, project_add_labels.py for extending an existing project’s
label schema, project_backup.py and project_restore.py for portable
copies, and project_export_dataset.py for dataset export (local + cloud).
For a CSV overview of a project’s jobs, see job_list.py --project-id --csv
in the job recipes.
Create, list, filter, retrieve, rename
Creates a project with labels, then lists all projects, filters by name,
retrieves by id, and renames it. Pass --cleanup to delete it at the end.
Flag
Required
Meaning
--host
yes
Server URL, e.g. 'https://app.cvat.ai'
--token
yes
Personal Access Token
--name
no
Project name (default 'Example project')
--labels
no
Label names, space-separated (default car person)
--cleanup
no
Delete the created project at the end
python project_create_and_list.py --host 'https://app.cvat.ai' --token '<your token>'\
--name 'My project' --labels car person
The script
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Create a project with labels, then list, filter, retrieve, and rename it.
Steps:
1. Create a project with a simple label schema.
2. List all projects visible to you (pagination is handled by the SDK).
3. Filter projects by a name substring.
4. Retrieve one project by id and read its labels.
5. Rename it.
6. Optionally delete it (--cleanup).
Usage (run ``python project_create_and_list.py --help`` for the full list of options):
python project_create_and_list.py --host 'https://app.cvat.ai' --token '<your token>' \\ --name 'My project' --labels car person
"""importargparsefromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.filtersimportFdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--name",default="Example project",help="project name (default: '%(default)s')")parser.add_argument("--labels",nargs="+",default=["car","person"],help="label names (default: %(default)s)",)parser.add_argument("--cleanup",action="store_true",help="delete the created project at the end")returnparser.parse_args()defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:# 1. Create a project with labelsproject=client.projects.create(models.ProjectWriteRequest(name=args.name,labels=[models.PatchedLabelRequest(name=name)fornameinargs.labels],))print(f"Created project {project.id}: {args.host}/projects/{project.id}")# 2. List all projectsprojects=client.projects.list()print(f"Projects visible to you: {len(projects)}")# 3. Filter by name substringmatches=client.projects.list(filter=F.name.contains(args.name))print(f"Projects with {args.name!r} in the name: {[p.idforpinmatches]}")# 4. Retrieve by idfetched=client.projects.retrieve(project.id)print(f"Project {fetched.id} labels: {[label.nameforlabelinfetched.get_labels()]}")# 5. Renamerenamed=fetched.update(models.PatchedProjectWriteRequest(name=f"{args.name} (renamed)"))print(f"Renamed to: {renamed.name}")# 6. Opt-in cleanupifargs.cleanup:renamed.remove()print(f"Deleted project {project.id}")else:print("Keeping the project; pass --cleanup to delete it")if__name__=="__main__":main()
Add labels to an existing project
Adds labels — optionally with selectable attributes — to a project that
already exists. Labels that are already there are skipped, so the recipe is
safe to re-run. The tasks inside the project take their labels from the
project itself, so they all pick up the change.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--project-id
yes
Id of the project to extend
--labels
yes
Label names to add, space-separated
--attr LABEL NAME VALUE [...]
no
Selectable attribute for one of the --labels; repeat for more
python project_add_labels.py --host 'https://app.cvat.ai' --token '<your token>'\
--project-id 7 --labels car person
python project_add_labels.py --host 'https://app.cvat.ai' --token '<your token>'\
--project-id 7 --labels car --attr car color red green blue
The script
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Add labels, optionally with selectable attributes, to an existing project.
Steps:
1. Retrieve the project and read the labels it already has; the requested
labels that already exist are skipped, so the script is safe to re-run.
2. Attach the --attr definitions to their new labels.
3. Send one project update with the new labels. Labels of the tasks inside
the project come from the project itself, so they all pick up the change.
Usage (run ``python project_add_labels.py --help`` for the full list of options):
python project_add_labels.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 7 --labels car person
python project_add_labels.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 7 --labels car --attr car color red green blue
"""importargparsefromcvat_sdkimportmake_client,modelsdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--project-id",type=int,required=True,help="id of an existing project, e.g. 7")parser.add_argument("--labels",nargs="+",metavar="NAME",required=True,help="label names to add")parser.add_argument("--attr",nargs="+",action="append",default=[],metavar=("LABEL NAME","VALUE"),help="selectable attribute for one of the --labels: label name, attribute ""name, then its values (repeat --attr for more attributes)",)args=parser.parse_args()forattrinargs.attr:iflen(attr)<3:parser.error("--attr needs a label, an attribute name, and at least one value")ifattr[0]notinargs.labels:parser.error(f"--attr refers to label {attr[0]!r}, which is not in --labels")returnargsdefmain()->None:args=parse_args()attributes_per_label:dict[str,list[models.AttributeRequest]]={}forlabel_name,attribute_name,*valuesinargs.attr:attributes_per_label.setdefault(label_name,[]).append(models.AttributeRequest(name=attribute_name,input_type=models.InputTypeEnum("select"),values=values,default_value=values[0],mutable=True,))withmake_client(args.host,access_token=args.token)asclient:project=client.projects.retrieve(args.project_id)existing={label.nameforlabelinproject.get_labels()}new_labels=[]fornameinargs.labels:ifnameinexisting:print(f"Label {name!r} already exists, skipping")continuenew_labels.append(models.PatchedLabelRequest(name=name,attributes=attributes_per_label.get(name,[])))ifnew_labels:project.update(models.PatchedProjectWriteRequest(labels=new_labels))print(f"Added {len(new_labels)} labels to project {project.id}: "f"{', '.join(label.nameforlabelinnew_labels)or'-'}")print(f"Project {project.id} labels: {[label.nameforlabelinproject.get_labels()]}")if__name__=="__main__":main()
Back up a project
Downloads a full project backup zip — tasks, jobs, annotations, and settings.
Pair with project_restore.py to migrate or clone.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Download a backup zip of an existing project.
A backup contains the project's tasks, jobs, annotations, and settings. Pair
this recipe with project_restore.py to migrate or clone a project.
Steps:
1. Retrieve the project by id.
2. Download its backup to --output (default: project_<id>_backup.zip).
Usage (run ``python project_backup.py --help`` for the full list of options):
python project_backup.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 42
"""importargparsefrompathlibimportPathfromcvat_sdkimportmake_clientdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--project-id",type=int,required=True,help="id of an existing project, e.g. 42")parser.add_argument("--output",type=Path,help="destination file path (default: project_<id>_backup.zip)",)returnparser.parse_args()defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:project=client.projects.retrieve(args.project_id)output=args.outputorPath(f"project_{project.id}_backup.zip")project.download_backup(output)print(f"Backed up project {project.id} to {output.resolve()}")if__name__=="__main__":main()
Restore a project
Restores a project from a backup zip as a brand-new project. Pass --cleanup
to delete the restored copy afterwards — useful when validating a backup file.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--backup
yes
Path to a project backup zip
--cleanup
no
Delete the restored copy (never touches the backup file)
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Restore a project from a backup zip as a new project.
Pair with project_backup.py to migrate or clone a project.
Steps:
1. Restore --backup as a brand-new project.
2. Optionally delete the restored copy (--cleanup) — useful when testing a
backup file.
Usage (run ``python project_restore.py --help`` for the full list of options):
python project_restore.py --host 'https://app.cvat.ai' --token '<your token>' \\ --backup './project_42_backup.zip'
"""importargparseimportsysfrompathlibimportPathfromcvat_sdkimportmake_clientdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--backup",type=Path,required=True,help="path to a project backup zip")parser.add_argument("--cleanup",action="store_true",help="delete the restored project at the end (never touches the source backup)",)returnparser.parse_args()defmain()->None:args=parse_args()ifnotargs.backup.is_file():sys.exit(f"--backup {args.backup} does not exist")withmake_client(args.host,access_token=args.token)asclient:restored=client.projects.create_from_backup(args.backup)print(f"Restored a copy as project {restored.id}: {args.host}/projects/{restored.id}")ifargs.cleanup:restored.remove()print(f"Deleted restored project {restored.id}")else:print("Keeping the restored project; pass --cleanup to delete it")if__name__=="__main__":main()
Export a project’s tasks individually (local + cloud)
Exports each task in a project as its own dataset, both to a local zip and
straight to a registered cloud storage. By default every task is exported;
pass --task-id to export only a specific subset. Validates the format name
against the server’s list before starting.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--project-id
yes
Id of the project to export
--cloud-storage-id
yes
Registered cloud storage id (see cloud_storage_register.py)
--export-format
no
Exporter name (default 'COCO 1.0')
--task-id
no
Task ids to export, space-separated (default: every task in the project)
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Export a project's tasks individually, without images, to local zips AND to
a registered cloud storage.
By default every task in the project is exported; pass --task-id to export
only a specific subset. This is the SDK-only stand-in for what could become a
bulk per-task export command in cvat-cli.
Steps:
1. Fetch the server's export format list and validate --export-format.
2. Resolve which tasks to export: --task-id filters to a subset of the
project's tasks; omit it to export every task in the project.
3. For each task: export to task_<id>_dataset.zip in the current directory,
then export the same dataset straight to the cloud storage (no local
download).
Usage (run ``python project_export_dataset.py --help`` for the full list of options):
# every task in the project
python project_export_dataset.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 42 --cloud-storage-id 7 --export-format 'COCO 1.0'
# only tasks 10 and 11
python project_export_dataset.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 42 --cloud-storage-id 7 --task-id 10 11
"""importargparseimportsysfrompathlibimportPathfromcvat_sdkimportmake_clientfromcvat_sdk.core.proxies.typesimportLocationdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--project-id",type=int,required=True,help="id of an existing project, e.g. 42")parser.add_argument("--cloud-storage-id",type=int,required=True,help="a registered cloud storage id (see cloud_storage_register.py)",)parser.add_argument("--export-format",default="COCO 1.0",help="exporter name, e.g. 'COCO 1.0' (default: '%(default)s')",)parser.add_argument("--task-id",type=int,nargs="+",metavar="ID",help="export only these task ids (must belong to the project); ""omit to export every task in the project",)returnparser.parse_args()defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:# 1. Validate the format against the server's list.# Low-level API: there is no high-level proxy for the format list yet.formats,_=client.api_client.server_api.retrieve_annotation_formats()names=[f.nameforfinformats.exporters]ifargs.export_formatnotinnames:sys.exit(f"Unknown export format {args.export_format!r}. Choose one of: {', '.join(names)}")# 2. Resolve which tasks to export.project=client.projects.retrieve(args.project_id)tasks_by_id={task.id:taskfortaskinproject.get_tasks()}ifargs.task_id:missing=[str(tid)fortidinargs.task_idiftidnotintasks_by_id]ifmissing:sys.exit(f"Task id(s) {', '.join(missing)} not found in project {project.id}")tasks=[tasks_by_id[tid]fortidinargs.task_id]else:tasks=list(tasks_by_id.values())ifnottasks:sys.exit(f"Project {project.id} has no tasks to export")# 3. Export each task individually: a local zip AND straight to the cloud storage.fortaskintasks:local_path=Path(f"task_{task.id}_dataset.zip")task.export_dataset(args.export_format,local_path,include_images=False,location=Location.LOCAL)print(f"Exported {local_path.resolve()}")remote_name=f"task_{task.id}_dataset.zip"task.export_dataset(args.export_format,remote_name,include_images=False,location=Location.CLOUD_STORAGE,cloud_storage_id=args.cloud_storage_id,)print(f"Exported {remote_name} to cloud storage {args.cloud_storage_id}")print(f"Exported {len(tasks)} task dataset(s) from project {project.id}")if__name__=="__main__":main()
Other SDK options:
SDK method / parameter
What it adds
Project.download_backup(..., lightweight=True)
Produce a smaller backup that omits media.
client.projects.create_from_dataset(...)
Create a project directly from a dataset archive.
Project.import_dataset(format_name, path)
Import annotations/data into an existing project - the import counterpart of export_dataset.
Project.get_annotations()
Fetch the project’s labeled data.
Notes:
list() returns the whole collection; pagination is handled for you.
A project backup captures tasks, jobs, users, and settings in a single zip -
but no raw media beyond what export_dataset would include.
For a CSV overview of a project’s jobs (no annotation geometry), use
job_list.py --project-id <id> --csv. For an actual dataset export,
use project_export_dataset.py.
include_images=False exports annotations only and is much smaller.
Create one task or a batch of tasks from a bucket; inspect and export existing tasks
Five recipes cover the task lifecycle: task_create_from_cloud.py creates one
task from object keys already in a registered bucket,
tasks_bulk_from_cloud.py creates a whole batch of tasks in a project from
that same bucket, task_inspect_and_export.py inspects an existing task,
exports its dataset locally, and reports analytics from its event log,
tasks_create_per_label_group.py splits annotation work over one set of images
into several tasks, one per shape type, and task_create_job_mapping.py creates
a task with an explicit file-to-job mapping.
Create a task from cloud object keys
Creates a task from images that already live in a registered bucket.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--cloud-storage-id
yes
Registered cloud storage id (see cloud_storage_register.py)
--cloud-keys
yes
Object keys in the bucket, space-separated
--name
no
Task name (default 'Task from cloud storage')
--labels
no
Label names, space-separated (default object)
--cleanup
no
Delete the created task at the end
python task_create_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>'\
--cloud-storage-id 7 --cloud-keys 'images/0001.jpg''images/0002.jpg'\
--labels car person
The script
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Create an annotation task from images that already live in a registered
cloud storage.
Steps:
1. Create a task whose data is a list of object keys in the bucket.
2. Print the result.
3. Optionally delete it (--cleanup).
Register a bucket first with cloud_storage_register.py to get the storage id.
Usage (run ``python task_create_from_cloud.py --help`` for the full list of options):
python task_create_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>' \\ --cloud-storage-id 7 --cloud-keys 'images/0001.jpg' 'images/0002.jpg' \\ --labels car person
"""importargparsefromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.tasksimportResourceTypedefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--cloud-storage-id",type=int,required=True,help="a registered cloud storage id (see cloud_storage_register.py)",)parser.add_argument("--cloud-keys",nargs="+",required=True,help="object keys in the bucket, e.g. 'images/0001.jpg' 'images/0002.jpg'",)parser.add_argument("--name",default="Task from cloud storage",help="task name (default: '%(default)s')",)parser.add_argument("--labels",nargs="+",default=["object"],help="label names (default: %(default)s)")parser.add_argument("--cleanup",action="store_true",help="delete the created task at the end")returnparser.parse_args()defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:# ResourceType.SHARE + cloud_storage_id = read images from the buckettask=client.tasks.create_from_data(spec=models.TaskWriteRequest(name=args.name,labels=[models.PatchedLabelRequest(name=name)fornameinargs.labels],),resource_type=ResourceType.SHARE,resources=args.cloud_keys,data_params={"cloud_storage_id":args.cloud_storage_id},)print(f"Created task {task.id} with {task.size} frames: {args.host}/tasks/{task.id}")ifargs.cleanup:task.remove()print(f"Deleted task {task.id}")else:print("Keeping the task; pass --cleanup to delete it")if__name__=="__main__":main()
Bulk-create tasks in a project from a bucket
Creates several tasks in one call, all inside the same project, each reading
its data from a registered cloud storage. Two ways to spell a task’s data,
repeatable and mixable: --task KEY[,KEY,...] lists explicit object keys (a
single key makes a video/single-image task; multiple keys make an image task
whose frames are those keys in order), and --task-pattern PATTERN makes one
task from every bucket file matching a fnmatch wildcard (e.g. 'batch_a/*.jpg'),
resolved from the bucket’s manifest instead of listing every key by hand.
Because every task belongs to the project, they share its label schema — no
--labels here.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--cloud-storage-id
yes
Registered cloud storage id (see cloud_storage_register.py)
--project-id
yes
Project the tasks are created in; supplies the labels
--task KEY[,KEY,...]
one of --task / --task-pattern
One --task per task; repeat the flag for more
--task-pattern PATTERN
one of --task / --task-pattern
One task per wildcard, matched via the bucket’s manifest; repeat for more
--manifest
no
Manifest object key used to resolve --task-pattern (default 'manifest.jsonl')
--name-prefix
no
Task-name prefix; each task is named <prefix> N (default 'Bulk task')
--cleanup
no
Delete every created task at the end
# three video tasks in project 42python tasks_bulk_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>'\
--cloud-storage-id 7 --project-id 42\
--task 'videos/clip_01.mp4' --task 'videos/clip_02.mp4' --task 'videos/clip_03.mp4'# two image-batch tasks in project 42python tasks_bulk_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>'\
--cloud-storage-id 7 --project-id 42\
--task 'batch_a/img_1.jpg,batch_a/img_2.jpg'\
--task 'batch_b/img_1.jpg,batch_b/img_2.jpg'# the same two batches, without listing every key: one task per wildcard matchpython tasks_bulk_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>'\
--cloud-storage-id 7 --project-id 42 --manifest manifest.jsonl \
--task-pattern 'batch_a/*.jpg' --task-pattern 'batch_b/*.jpg'
The script
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Bulk-create tasks inside a project, each task's data read from a registered
cloud storage.
Two ways to spell a task's data, repeatable and mixable:
--task KEY[,KEY,...] explicit object keys, in order:
* a single key -> a video task (or single-image task);
* several keys -> an image task, in the given order.
--task-pattern PATTERN every bucket file matching a fnmatch wildcard (e.g.
'batch_a/*.jpg'), resolved from the bucket's
manifest instead of being listed one by one.
All tasks land in the same project, so they share its label schema.
Steps:
1. For each --task, create a task in --project-id from its explicit keys.
2. For each --task-pattern, create a task in --project-id from every bucket
file the wildcard matches, resolved via the bucket's manifest.
3. Print the created ids and a summary count.
4. Optionally delete every created task (--cleanup).
Register a bucket first with cloud_storage_register.py to get the storage id.
A --task-pattern also needs a manifest file already generated for the bucket -
see "How to generate manifest file" in the CVAT docs on attaching cloud storage.
Usage (run ``python tasks_bulk_from_cloud.py --help`` for the full list of options):
# three video tasks in project 42
python tasks_bulk_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>' \\ --cloud-storage-id 7 --project-id 42 \\ --task 'videos/clip_01.mp4' --task 'videos/clip_02.mp4' --task 'videos/clip_03.mp4'
# two image-batch tasks in project 42
python tasks_bulk_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>' \\ --cloud-storage-id 7 --project-id 42 \\ --task 'batch_a/img_1.jpg,batch_a/img_2.jpg' \\ --task 'batch_b/img_1.jpg,batch_b/img_2.jpg'
# the same two batches, without listing every key: one task per wildcard match
python tasks_bulk_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>' \\ --cloud-storage-id 7 --project-id 42 --manifest manifest.jsonl \\ --task-pattern 'batch_a/*.jpg' --task-pattern 'batch_b/*.jpg'
"""importargparsefromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.tasksimportResourceTypedefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--cloud-storage-id",type=int,required=True,help="a registered cloud storage id (see cloud_storage_register.py)",)parser.add_argument("--project-id",type=int,required=True,help="tasks are created in this project and inherit its labels",)parser.add_argument("--task",dest="tasks",action="append",default=[],metavar="KEY[,KEY,...]",help="comma-separated object keys for one task; repeat for more tasks",)parser.add_argument("--task-pattern",dest="task_patterns",action="append",default=[],metavar="PATTERN",help="one task from every bucket file matching this fnmatch wildcard ""(e.g. 'batch_a/*.jpg'); repeat for more tasks. Needs --manifest. ""(default: '%(default)s')",)parser.add_argument("--manifest",default="manifest.jsonl",help="manifest object key in the bucket, used to resolve --task-pattern ""(default: '%(default)s')",)parser.add_argument("--name-prefix",default="Bulk task",help="task name prefix; each task is named '<prefix> N' (default: '%(default)s')",)parser.add_argument("--cleanup",action="store_true",help="delete every created task at the end")args=parser.parse_args()ifnotargs.tasksandnotargs.task_patterns:parser.error("at least one --task or --task-pattern is required")returnargsdefmain()->None:args=parse_args()task_key_groups=[[key.strip()forkeyinspec.split(",")ifkey.strip()]forspecinargs.tasks]ifany(notgroupforgroupintask_key_groups):raiseSystemExit("each --task must contain at least one non-empty key")withmake_client(args.host,access_token=args.token)asclient:created=[]forkeysintask_key_groups:# Tasks in a project inherit the project's labels — do NOT pass labels.# ResourceType.SHARE + cloud_storage_id reads the objects from the bucket.task=client.tasks.create_from_data(spec=models.TaskWriteRequest(name=f"{args.name_prefix}{len(created)+1}",project_id=args.project_id),resource_type=ResourceType.SHARE,resources=keys,data_params={"cloud_storage_id":args.cloud_storage_id},)created.append(task)print(f"Created task {task.id} ({task.size} frames): {args.host}/tasks/{task.id}")forpatterninargs.task_patterns:# A wildcard task needs the bucket's manifest as its only resource;# the server expands filename_pattern against it (fnmatch syntax).# use_cache=True is required to serve data straight from the bucket.task=client.tasks.create_from_data(spec=models.TaskWriteRequest(name=f"{args.name_prefix}{len(created)+1}",project_id=args.project_id),resource_type=ResourceType.SHARE,resources=[args.manifest],data_params={"cloud_storage_id":args.cloud_storage_id,"use_cache":True,"filename_pattern":pattern,},)created.append(task)print(f"Created task {task.id} ({task.size} frames) from pattern {pattern!r}: "f"{args.host}/tasks/{task.id}")print(f"Created {len(created)} tasks in project {args.project_id}")ifargs.cleanup:fortaskincreated:task.remove()print(f"Deleted {len(created)} tasks")else:print("Keeping the tasks; pass --cleanup to delete them")if__name__=="__main__":main()
Inspect a task and export its dataset
Prints a summary of an existing task (labels, jobs, frames), exports its
dataset to a local zip, then exports the task’s event log and reports two
analytics computed from it: how many people are currently assigned to a job,
and how many jobs were rejected in review and sent back for rework.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Inspect an existing task (labels, jobs, frames), export its dataset to a
local zip, and export its event log to report quick analytics.
Steps:
1. Retrieve the task and print a summary: labels, jobs (stage/state), frames.
2. Fetch the server's export format list and validate --export-format.
3. Export the dataset to task_<id>_dataset.zip in the current directory.
4. Export the task's event log to task_<id>_events.csv and report two
analytics: how many people are currently assigned to a job, and how
many jobs were rejected in review and sent back for rework - the second
one needs the log, since a job's current state doesn't show its history.
Usage (run ``python task_inspect_and_export.py --help`` for the full list of options):
python task_inspect_and_export.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --export-format 'COCO 1.0'
"""importargparseimportcsvimportsysfrompathlibimportPathfromcvat_sdkimportmake_clientfromcvat_sdk.core.downloadingimportDownloaderfromcvat_sdk.core.proxies.typesimportLocationdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--task-id",type=int,required=True,help="id of an existing task, e.g. 42")parser.add_argument("--export-format",default="COCO 1.0",help="exporter name, e.g. 'COCO 1.0' (default: '%(default)s')",)returnparser.parse_args()defcount_reworks(events_path:Path)->int:"""Count how many times a job in the log was rejected in review, i.e. sent
back to the annotator for rework. A job's current state only shows where
it stands now, not how many times it got there, so this needs the log.
"""withevents_path.open(newline="")asf:returnsum(1forrowincsv.DictReader(f)ifrow["scope"]=="update:job"androw["obj_name"]=="state"androw["obj_val"]=="rejected")defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:# 1. Inspecttask=client.tasks.retrieve(args.task_id)jobs=task.get_jobs()print(f"Task {task.id}: {task.name!r}, {task.size} frames")print(f" labels: {[label.nameforlabelintask.get_labels()]}")forjobinjobs:print(f" job {job.id}: stage={job.stage}, state={job.state}")# 2. Validate the export format against the server's list.# Low-level API: there is no high-level proxy for the format list yet.formats,_=client.api_client.server_api.retrieve_annotation_formats()names=[f.nameforfinformats.exporters]ifargs.export_formatnotinnames:sys.exit(f"Unknown export format {args.export_format!r}. Choose one of: {', '.join(names)}")# 3. Export the dataset to a local ziplocal_path=Path(f"task_{task.id}_dataset.zip")task.export_dataset(args.export_format,local_path,include_images=False,location=Location.LOCAL)print(f"Exported {local_path.resolve()}")# 4. Export the task's event log and report quick analytics.events_path=Path(f"task_{task.id}_events.csv")Downloader(client).prepare_and_download_file_from_endpoint(client.api_client.events_api.create_export_endpoint,events_path,query_params={"task_id":task.id},)print(f"Exported {events_path.resolve()}")assigned={job.assignee.idforjobinjobsifjob.assignee}print(f" {len(assigned)} people currently assigned, {count_reworks(events_path)} reworks")if__name__=="__main__":main()
Split work into one task per label group
Creates one task per --task 'NAME:TYPE:label1,label2' spec over the same
images, with that spec’s labels typed to its shape type. Boxes, polygons, and
tags then get annotated in parallel, each in a task that shows only the labels
its annotator needs.
The tasks are standalone, not tasks of one project: tasks in a project share
the project’s label set, so a per-task label set cannot exist inside a single
project — the SDK rejects labels on a task that has a project_id. Every spec
is validated before anything is created, and --cleanup deletes the tasks
created so far even if a later one fails.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--image-dir
yes
Directory with the images to annotate; every file in it is uploaded
--task NAME:TYPE:LABELS
yes
One task; repeat for more
--segment-size
no
Frames per job, in every task
--cleanup
no
Delete the created tasks at the end
TYPE is one of rectangle, polygon, polyline, points, ellipse,
cuboid, mask, tag, any.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Create one task per shape type and label group over the same set of images,
so boxes, polygons, and tags are annotated in parallel by different people
instead of all at once in one crowded task.
Each --task spec is 'NAME:TYPE:label1,label2': the task's name, the shape type
its labels are drawn with, and the labels themselves.
The tasks are standalone, not tasks of one project: tasks in a project share the
project's label set, so a per-task label set cannot exist inside a single
project.
Steps:
1. Parse and validate every --task spec before creating anything.
2. Collect the files from --image-dir.
3. Create one task per spec, with that spec's labels typed to its shape type.
4. Print a summary of what each task got.
Usage (run ``python tasks_create_per_label_group.py --help`` for the full list of options):
python tasks_create_per_label_group.py --host 'https://app.cvat.ai' --token '<your token>' \\ --image-dir ./images \\ --task 'boxes:rectangle:car,person' \\ --task 'roads:polygon:road,lane' \\ --task 'weather:tag:rain,snow'
"""importargparseimportsysfrompathlibimportPathfromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.tasksimportResourceTypeLABEL_TYPES={"any","cuboid","ellipse","mask","points","polygon","polyline","rectangle","tag",}defparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--image-dir",type=Path,required=True,help="directory with the images to annotate; every file in it is uploaded, ""and the server decides which media it accepts",)parser.add_argument("--task",action="append",required=True,metavar="NAME:TYPE:LABELS",help="one task, e.g. 'boxes:rectangle:car,person' (repeat for more)",)parser.add_argument("--segment-size",type=int,help="frames per job, in every task")parser.add_argument("--cleanup",action="store_true",help="delete the created tasks at the end")returnparser.parse_args()defparse_spec(spec:str)->tuple[str,str,list[str]]:"""'boxes:rectangle:car,person' -> ('boxes', 'rectangle', ['car', 'person'])."""name,_,rest=spec.partition(":")type_,_,labels=rest.partition(":")names=[label.strip()forlabelinlabels.split(",")iflabel.strip()]ifnot(nameandtype_andnames):sys.exit(f"Bad --task {spec!r}: expected 'NAME:TYPE:label1,label2'")iftype_notinLABEL_TYPES:sys.exit(f"Unknown label type {type_!r} in --task {spec!r}. "f"Choose one of: {', '.join(sorted(LABEL_TYPES))}")returnname,type_,namesdefmain()->None:args=parse_args()# 1. Validate every spec first, so a typo in the last one costs nothing.specs=[parse_spec(spec)forspecinargs.task]# 2. The same files go into every task. They are passed as they are found:# the server is the authority on which media formats it supports, so# filtering by extension here would only reject files CVAT can read.images=sorted(pforpinargs.image_dir.iterdir()ifp.is_file())ifnotimages:sys.exit(f"No files found in {args.image_dir}")created=[]withmake_client(args.host,access_token=args.token)asclient:try:forname,type_,label_namesinspecs:task=client.tasks.create_from_data(spec=models.TaskWriteRequest(name=name,labels=[models.PatchedLabelRequest(name=label,type=type_)forlabelinlabel_names],**({"segment_size":args.segment_size}ifargs.segment_sizeelse{}),),resource_type=ResourceType.LOCAL,resources=images,)created.append(task)print(f"Created task {task.id}{name!r} "f"({type_}: {', '.join(label_names)}, {len(task.get_jobs())} job(s)): "f"{args.host}/tasks/{task.id}")print(f"Created {len(created)} task(s) from {len(images)} file(s)")finally:# Clean up whatever was created, including after a mid-run failure.ifargs.cleanup:fortaskincreated:task.remove()print(f"Deleted task {task.id}")elifcreated:print("Keeping the tasks; pass --cleanup to delete them")if__name__=="__main__":main()
Decide which files go into which job
Normally CVAT cuts a task into jobs of segment_size frames. The
job_file_mapping data parameter replaces that with an explicit grouping: one
job per camera, per scene, or per delivery batch. Group the files yourself with
repeated --job flags, or chunk the directory with --files-per-job N — a
count of files, the explicit equivalent of segment_size.
Every file in --image-dir must belong to exactly one job — unknown files,
duplicates, and leftovers are rejected before the task is created. Afterwards
the recipe reads the jobs back from the server and writes
job_file_mapping.csv, one job_id,frame,file_name row per file: the mapping
you see is the one that exists, and every file names the frame it actually
landed on. Frame numbers are zero-based indexes within the task.
The example creates one object label so the task is ready for annotation.
job_file_mapping implies predefined file ordering and takes one file per
frame, so it applies to image tasks only: a video is a single file the server
cuts into frames itself, and there is nothing to map. CVAT rejects the request
if the task’s data turns out to be a video.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--image-dir
yes
Directory with the task’s images, one file per frame
--job FILE [FILE ...]
one of --job / --files-per-job
The files of one job; repeat for more
--files-per-job N
one of --job / --files-per-job
Number of files per job: chunk the directory into jobs of N files each
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Create a task whose jobs are defined by you, file by file, instead of by a
frame count: one job per camera, per scene, per delivery batch.
Two ways to group:
--job FILE [FILE ...] one job per occurrence, in the given file order
--files-per-job N a count, not a file list: chunk the sorted directory
listing into jobs of N files each, the explicit
equivalent of the task's segment_size
Steps:
1. Build the file groups and check them against --image-dir: every file must
exist, appear once, and belong to a job.
2. Create the task with the job_file_mapping data parameter.
3. Read the jobs back from the server and print/write the resulting mapping,
so what you see is what the server built, not what was requested.
job_file_mapping implies predefined file ordering and takes one file per frame,
so it applies to image tasks only: a video is a single file the server cuts into
frames itself, and there is nothing to map. A directory of images is therefore
what this recipe takes, and CVAT rejects the request if the data turns out to be
a video.
Usage (run ``python task_create_job_mapping.py --help`` for the full list of options):
python task_create_job_mapping.py --host 'https://app.cvat.ai' --token '<your token>' \\ --image-dir ./images \\ --job 'cam1_001.png' 'cam1_002.png' --job 'cam2_001.png' 'cam2_002.png'
python task_create_job_mapping.py --host 'https://app.cvat.ai' --token '<your token>' \\ --image-dir ./images --files-per-job 50
"""importargparseimportcsvimportsysfrompathlibimportPathfromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.tasksimportResourceTypedefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--image-dir",type=Path,required=True,help="directory with the task's images, one file per frame (a video cannot be ""mapped to jobs file by file)",)grouping=parser.add_mutually_exclusive_group(required=True)grouping.add_argument("--job",action="append",nargs="+",metavar="FILE",help="the files of one job (repeat for more jobs)",)grouping.add_argument("--files-per-job",type=int,metavar="N",help="number of files per job: chunk the sorted directory listing into jobs of N ""files each (the explicit equivalent of the task's segment_size)",)parser.add_argument("--name",default="Task with a job file mapping",help="task name")parser.add_argument("--output",type=Path,default=Path("job_file_mapping.csv"),help="path to write the resulting mapping to (default: %(default)s)",)parser.add_argument("--cleanup",action="store_true",help="delete the created task at the end")returnparser.parse_args()defbuild_groups(args:argparse.Namespace,available:list[str])->list[list[str]]:"""The file groups to send as job_file_mapping, validated against the directory."""ifargs.files_per_job:ifargs.files_per_job<1:sys.exit("--files-per-job must be at least 1")return[available[start:start+args.files_per_job]forstartinrange(0,len(available),args.files_per_job)]groups=[list(group)forgroupinargs.job]known=set(available)assigned=[]forgroupingroups:assigned.extend(group)unknown=[namefornameinassignedifnamenotinknown]ifunknown:sys.exit(f"File(s) {', '.join(unknown)} not found in {args.image_dir}")duplicates=sorted({namefornameinassignedifassigned.count(name)>1})ifduplicates:sys.exit(f"File(s) {', '.join(duplicates)} appear in more than one job")unassigned=sorted(known-set(assigned))ifunassigned:sys.exit(f"File(s) {', '.join(unassigned)} are not assigned to any job. ""Every file in --image-dir must belong to exactly one --job.")returngroupsdefmain()->None:args=parse_args()# The files are taken as they are found: the server is the authority on# which media formats it supports, so filtering by extension here would# only reject files CVAT can read.available=sorted(p.nameforpinargs.image_dir.iterdir()ifp.is_file())ifnotavailable:sys.exit(f"No files found in {args.image_dir}")groups=build_groups(args,available)resources=[args.image_dir/nameforgroupingroupsfornameingroup]print(f"Requesting {len(groups)} job(s) over {len(resources)} file(s)")withmake_client(args.host,access_token=args.token)asclient:task=client.tasks.create_from_data(spec=models.TaskWriteRequest(name=args.name,labels=[models.PatchedLabelRequest(name="object")],),resource_type=ResourceType.LOCAL,resources=resources,data_params={"job_file_mapping":groups},)print(f"Created task {task.id} with {task.size} frames: {args.host}/tasks/{task.id}")# 3. The mapping is built using one row per file, carrying# the frame that file ended up on. A job's frames come back in order,# so the frame is the job's start plus the file's position in it.rows=[]forjobinsorted(task.get_jobs(),key=lambdajob:job.start_frame):names=[frame.nameforframeinjob.get_frames_info()]print(f" job {job.id} frames {job.start_frame}-{job.stop_frame}: {', '.join(names)}")rows.extend({"job_id":job.id,"frame":job.start_frame+offset,"file_name":name}foroffset,nameinenumerate(names))withargs.output.open("w",newline="")asf:writer=csv.DictWriter(f,fieldnames=["job_id","frame","file_name"])writer.writeheader()writer.writerows(rows)print(f"Wrote {args.output.resolve()}")ifargs.cleanup:task.remove()print(f"Deleted task {task.id}")else:print("Keeping the task; pass --cleanup to delete it")if__name__=="__main__":main()
status_check_period (int, seconds) is the upload status poll interval (defaults to Config.status_check_period); pbar is a cvat_sdk.core.progress.ProgressReporter for upload progress.
client.tasks.list(..., search=, sort=)
Free-text search and server-side ordering (sort), in addition to filter.
client.tasks.create_from_backup(path)
Recreate a task from a task backup archive.
Task.import_annotations(format_name, path)
Load annotations into an existing task - the import counterpart of export_dataset.
Return a single frame as a file-like object (io.RawIOBase) of image bytes. quality is an optional keyword argument ("original" or "compressed"); if omitted, the server default is used.
List a task’s or project’s jobs, round-robin unassigned jobs, batch-advance completed jobs
Three recipes: job_list.py lists a task’s or project’s jobs with optional
stage/state filters and an optional CSV report, job_assign.py round-robins
unassigned jobs across a resolved pool of users and writes a CSV report, and
job_workflow.py batch-advances every completed job at a given stage to the
next stage.
List a task’s or project’s jobs
Queries the jobs of a task or a project (pick one with --task-id or
--project-id) with optional server-side --stage / --state filters,
ordered by most recently updated. Pass --csv to also write report.csv
(project_id, project_name, task_id, task_name, job_id, stage, state, assignee, frames) into the current directory.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""List the jobs of an existing task or project with their stage, state, and
assignee, optionally as a CSV report.
Steps:
1. Query jobs scoped to --task-id or --project-id, most recently updated
first. --stage / --state filter server-side, so large tasks/projects
stay cheap. The same endpoint also accepts free-text search, e.g.
search='alice'.
2. Print one row per job.
3. If --csv is passed, also write report.csv into the current directory
(project_id, project_name, task_id, task_name, job_id, stage, state,
assignee, frames).
Usage (run ``python job_list.py --help`` for the full list of options):
python job_list.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42
python job_list.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --stage annotation --state new
python job_list.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 7 --csv
"""importargparseimportcsvfromcollections.abcimportIterablefrompathlibimportPathfromcvat_sdkimportmake_clientfromcvat_sdk.core.filtersimportF,all_fromcvat_sdk.core.proxies.jobsimportJobdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)scope=parser.add_mutually_exclusive_group(required=True)scope.add_argument("--task-id",type=int,help="id of an existing task, e.g. 42")scope.add_argument("--project-id",type=int,help="id of an existing project, e.g. 7")parser.add_argument("--stage",help="only jobs at this stage, e.g. 'annotation'")parser.add_argument("--state",help="only jobs in this state, e.g. 'new'")parser.add_argument("--csv",action="store_true",help="also write report.csv into the current directory")returnparser.parse_args()defwrite_report(jobs:Iterable[Job],path:Path)->None:withpath.open("w",newline="")asf:writer=csv.writer(f)writer.writerow(["project_id","project_name","task_id","task_name","job_id","stage","state","assignee","frames",])forjobinjobs:assignee=job.assignee.usernameifjob.assigneeelse""writer.writerow([job.project_idor"",job.project_nameor"",job.task_id,job.task_name,job.id,job.stage,job.state,assignee,job.frame_count,])defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:ifargs.task_idisnotNone:conditions=[F.task_id==args.task_id]scope_label=f"Task {args.task_id}"else:conditions=[F.project_id==args.project_id]scope_label=f"Project {args.project_id}"ifargs.stage:conditions.append(F.stage==args.stage)ifargs.state:conditions.append(F.state==args.state)jobs=client.jobs.list(filter=all_(*conditions),sort="-updated_date")print(f"{scope_label}: {len(jobs)} matching jobs")forjobinjobs:assignee=job.assignee.usernameifjob.assigneeelse"-"print(f" job {job.id}: stage={job.stage}, state={job.state}, assignee={assignee}")ifargs.csv:report_path=Path("report.csv")write_report(jobs,report_path)print(f"Wrote {report_path.resolve()}")if__name__=="__main__":main()
Round-robin assign a task’s jobs
Distributes the unassigned jobs of a task across a resolved user pool and
writes assignments.csv (job_id, previous_assignee, new_assignee, new_assignee_id). The pool is resolved by looking up usernames exactly with
--assignees, by searching an organization’s members with --search, or
self-assigns if neither is passed.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--task-id
yes
Id of the task
--org SLUG
no
Organization slug to scope the user and job queries
--org-id ID
no
Organization id, as an alternative to --org
--assignees USERNAME [...]
no
Usernames to round-robin (exact match)
--search QUERY
no
Search the organization’s members; every match becomes an assignee
--assignees and --search are mutually exclusive, and so are --org and
--org-id. Omit both --assignees and --search to self-assign.
--search requires an organization, so pass it together with --org or
--org-id. Search matches the username, first_name, and last_name
fields, which is only meaningful scoped to a team.
# self-assign every unassigned jobpython job_assign.py --host 'https://app.cvat.ai' --token '<your token>'\
--task-id 42# round-robin across an explicit poolpython job_assign.py --host 'https://app.cvat.ai' --token '<your token>'\
--task-id 42 --assignees alice bob
# pool = every organization member matching the searchpython job_assign.py --host 'https://app.cvat.ai' --token '<your token>'\
--task-id 42 --org 'annotators' --search 'annotator-team'
The script
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Round-robin the unassigned jobs of a task across a set of annotators and
write a CSV report of the assignments (job_id, previous_assignee, new_assignee).
The user API supports server-side search within an organization, so you rarely
need to know user ids — pass usernames, or an organization and search query,
and let the recipe resolve them.
Steps:
1. Resolve the assignee pool:
--assignees USERNAME [USERNAME ...] : look up each username exactly.
--search QUERY --org SLUG : search organization members,
print the matches, use them all.
--search QUERY --org-id ID : same, using the organization id.
neither : assign to me (the authenticated user).
2. Filter the task's unassigned jobs.
3. Round-robin the jobs across the resolved users.
4. Write assignments.csv into the current directory.
Usage (run ``python job_assign.py --help`` for the full list of options):
python job_assign.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 # self-assign
python job_assign.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --assignees alice bob
python job_assign.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --org 'annotators' --search 'annotator-team'
# pool = matches in the organization
"""importargparseimportcsvimportsysfrompathlibimportPathfromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.filtersimportF,all_,not_fromcvat_sdk.core.proxies.usersimportUserdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--task-id",type=int,required=True,help="id of an existing task, e.g. 42")organization=parser.add_mutually_exclusive_group()organization.add_argument("--org",metavar="SLUG",help="organization slug to scope user and job queries")organization.add_argument("--org-id",type=int,metavar="ID",help="organization id to scope user and job queries")group=parser.add_mutually_exclusive_group()group.add_argument("--assignees",nargs="+",metavar="USERNAME",help="usernames to round-robin across (looked up exactly on the server)",)group.add_argument("--search",metavar="QUERY",help="server-side search within --org/--org-id; every matching member becomes an assignee",)args=parser.parse_args()ifargs.searchandargs.orgisNoneandargs.org_idisNone:parser.error("--search requires --org or --org-id")returnargsdeforganization_filters(args:argparse.Namespace)->dict[str,str|int]:ifargs.orgisnotNone:return{"org":args.org}ifargs.org_idisnotNone:return{"org_id":args.org_id}return{}defresolve_pool(client,args:argparse.Namespace)->list[User]:"""Resolve --assignees / --search / nothing to a list of User objects."""org_filters=organization_filters(args)ifargs.search:matches=client.users.list(search=args.search,**org_filters)ifnotmatches:sys.exit(f"No users matched search {args.search!r}")print(f"Users matching {args.search!r}:")foruserinmatches:print(f" {user.id}\t{user.username}")returnmatchesifargs.assignees:pool:list[User]=[]forusernameinargs.assignees:found=client.users.list(filter=F.username==username,**org_filters)ifnotfound:sys.exit(f"User {username!r} not found")pool.append(found[0])returnpoolme=client.users.retrieve_current_user()print(f"No --assignees / --search; self-assigning as {me.username} (id={me.id})")return[me]defmain()->None:args=parse_args()report_path=Path("assignments.csv")withmake_client(args.host,access_token=args.token)asclient:pool=resolve_pool(client,args)unassigned=client.jobs.list(filter=all_(F.task_id==args.task_id,not_(F.assignee.is_set())),**organization_filters(args),)print(f"Task {args.task_id}: {len(unassigned)} unassigned jobs to distribute")withreport_path.open("w",newline="")asf:writer=csv.writer(f)writer.writerow(["job_id","previous_assignee","new_assignee","new_assignee_id"])fori,jobinenumerate(unassigned):user=pool[i%len(pool)]previous=job.assignee.usernameifjob.assigneeelse""job.update(models.PatchedJobWriteRequest(assignee=user.id))writer.writerow([job.id,previous,user.username,user.id])print(f"Assigned job {job.id} -> {user.username} (id={user.id})")print(f"Wrote {report_path.resolve()}")if__name__=="__main__":main()
Batch-advance completed jobs
Finds every job whose state is completed at --from-stage and moves each
one to the next stage (annotation → validation → acceptance). Optionally
restrict the sweep to a single task.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--from-stage
yes
Advance completed jobs at this stage (annotation or validation)
--task-id
no
Restrict the sweep to a single task
# send everything annotators finished into reviewpython job_workflow.py --host 'https://app.cvat.ai' --token '<your token>'\
--from-stage annotation
# accept everything that passed review, scoped to one taskpython job_workflow.py --host 'https://app.cvat.ai' --token '<your token>'\
--from-stage validation --task-id 42
The script
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Batch-advance completed jobs to the next workflow stage
Find every job whose state is 'completed' at --from-stage, move each one to
the next stage, and print the list of modified jobs. Optionally restrict the
sweep to a single task with --task-id.
Steps:
1. Query jobs matching (stage == --from-stage, state == 'completed').
2. Update each job's stage to the next one in the workflow.
3. Print the modified job ids.
Usage (run ``python job_workflow.py --help`` for the full list of options):
# Send everything annotators finished into review:
python job_workflow.py --host 'https://app.cvat.ai' --token '<your token>' \\ --from-stage annotation
# Accept everything that passed review, scoped to one task:
python job_workflow.py --host 'https://app.cvat.ai' --token '<your token>' \\ --from-stage validation --task-id 42
"""importargparsefromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.filtersimportF,all_NEXT_STAGE={"annotation":"validation","validation":"acceptance"}defparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--from-stage",required=True,choices=sorted(NEXT_STAGE),help="advance completed jobs currently at this stage",)parser.add_argument("--task-id",type=int,help="restrict the sweep to a single task (default: every task you can see)",)returnparser.parse_args()defmain()->None:args=parse_args()to_stage=NEXT_STAGE[args.from_stage]withmake_client(args.host,access_token=args.token)asclient:conditions=[F.stage==args.from_stage,F.state=="completed"]ifargs.task_idisnotNone:conditions.append(F.task_id==args.task_id)jobs=client.jobs.list(filter=all_(*conditions))print(f"Found {len(jobs)} completed jobs at stage {args.from_stage!r}")forjobinjobs:job.update(models.PatchedJobWriteRequest(stage=to_stage))print(f" job {job.id}: {args.from_stage} -> {to_stage}")print(f"Moved {len(jobs)} jobs to stage {to_stage!r}")if__name__=="__main__":main()
Return a single frame as a file-like object (io.RawIOBase) of image bytes. quality is an optional keyword argument ("original" or "compressed"); if omitted, the server default is used.
Save the given frames to disk under outdir. image_extension (e.g. "png") overrides the auto-detected extension; quality is "original" or "compressed".
Job.get_meta() / Job.get_labels()
Read a job’s frame metadata and label schema.
Notes:
stage is one of annotation, validation, acceptance; state is one of
new, in progress, rejected, completed.
Jobs are created automatically with their task (controlled by segment_size
at task creation) — you can update and assign them, but not create a job on
its own.
CVAT has no built-in auto-assignment, so job_assign.py is the scripted
pattern.
Import annotations into a task from a file or a bucket, edit them in bulk, aggregate statistics, and find objects annotated twice
Five recipes: task_import_annotations.py loads an annotation file into an
existing task, task_import_annotations_from_cloud.py does the same with a
file that stays in a registered cloud storage, task_edit_annotations.py
reads a task’s annotations, applies a bulk edit, and writes it back,
project_annotation_stats.py walks a project’s tasks and aggregates object
counts per label and type into a CSV report, and project_find_duplicates.py
finds objects that were annotated twice before you export them.
Import annotations into a task
Uploads a local annotations file (e.g., predictions of a model, or work
exported from another server) into an existing task, and shows the object
counts before and after, so you can see what the import added. The import
format is validated against the server’s importer list.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Import annotations from a local file into an existing task, e.g. to load
predictions of a model or work made on another server.
Steps:
1. Retrieve the task and count the objects it already has.
2. Fetch the server's import format list and validate --import-format.
3. Upload the annotations file and wait for the server to process it.
4. Count the objects again to show what the import added.
Usage (run ``python task_import_annotations.py --help`` for the full list of options):
python task_import_annotations.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --annotations-file 'annotations.zip' --import-format 'COCO 1.0'
"""importargparseimportsysfrompathlibimportPathfromcvat_sdkimportmake_clientdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--task-id",type=int,required=True,help="id of an existing task, e.g. 42")parser.add_argument("--annotations-file",type=Path,required=True,help="file to import, e.g. 'annotations.zip'",)parser.add_argument("--import-format",default="COCO 1.0",help="importer name, e.g. 'COCO 1.0' (default: '%(default)s')",)returnparser.parse_args()defcount_objects(task)->int:"""All annotation objects of a task: tags, shapes, and tracks."""annotations=task.get_annotations()returnlen(annotations.tags)+len(annotations.shapes)+len(annotations.tracks)defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:task=client.tasks.retrieve(args.task_id)print(f"Task {task.id}: {count_objects(task)} objects before import")formats,_=client.api_client.server_api.retrieve_annotation_formats()names=[f.nameforfinformats.importers]ifargs.import_formatnotinnames:sys.exit(f"Unknown import format {args.import_format!r}. Choose one of: {', '.join(names)}")task.import_annotations(args.import_format,args.annotations_file)print(f"Imported {args.annotations_file} as {args.import_format!r}")print(f"Task {task.id}: {count_objects(task)} objects after import")if__name__=="__main__":main()
Import annotations from a cloud storage
Imports an annotation file that is already in a registered bucket: CVAT
downloads the object itself, so nothing is uploaded from the machine running
the script. Useful when a model writes its predictions to the bucket, or when
the archive is too big to push through your own connection.
The high-level Task.import_annotations() always uploads a local file, so this
recipe posts the import request through the low-level
client.api_client.tasks_api with location=Location.CLOUD_STORAGE and awaits
the returned rq_id with client.wait_for_completion().
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--task-id
yes
Id of the task to import into
--filename
yes
Object key in the bucket, e.g. 'annotations/task_42.zip'
--cloud-storage-id
no
Registered cloud storage id; omit to use the task’s own source storage
--import-format
no
Importer name (default 'COCO 1.0')
--import-mode
no
append (default) or replace
# explicit bucketpython task_import_annotations_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>'\
--task-id 42 --cloud-storage-id 7 --filename 'annotations/task_42.zip'\
--import-format 'COCO 1.0'# the bucket configured as the task's source storage, replacing what the task haspython task_import_annotations_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>'\
--task-id 42 --filename 'predictions/task_42.zip' --import-mode replace
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Import annotations into an existing task straight from a registered cloud
storage: the server pulls the file out of the bucket itself, nothing is
uploaded from this machine. Handy when a model writes its predictions to a
bucket, or when the annotation archive is too big to push through your own
connection.
The high-level Task.import_annotations() always uploads a local file, so the
import request is made with the low-level API (client.api_client.tasks_api)
and awaited with client.wait_for_completion.
Steps:
1. Retrieve the task and count the objects it already has.
2. Fetch the server's import format list and validate --import-format.
3. Resolve the storage to read from: --cloud-storage-id, or the task's own
source storage when the flag is omitted.
4. Start the import and wait for the background request to finish.
5. Count the objects again to show what the import added.
Register a bucket first with cloud_storage_register.py to get the storage id.
Usage (run ``python task_import_annotations_from_cloud.py --help`` for the full list of options):
python task_import_annotations_from_cloud.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --cloud-storage-id 7 --filename 'annotations/task_42.zip' \\ --import-format 'COCO 1.0'
"""importargparseimportjsonimportsysfromcvat_sdkimportmake_clientfromcvat_sdk.core.exceptionsimportBackgroundRequestExceptionfromcvat_sdk.core.proxies.typesimportLocationdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--task-id",type=int,required=True,help="id of an existing task, e.g. 42")parser.add_argument("--filename",required=True,help="object key of the annotation file in the bucket, e.g. 'annotations/task_42.zip'",)parser.add_argument("--cloud-storage-id",type=int,help="a registered cloud storage id (see cloud_storage_register.py); ""omit to use the source storage configured in the task",)parser.add_argument("--import-format",default="COCO 1.0",help="importer name, e.g. 'COCO 1.0' (default: '%(default)s')",)parser.add_argument("--import-mode",choices=["append","replace"],default="append",help="add to the task's annotations or replace them; the default keeps what ""the task already has (default: '%(default)s')",)returnparser.parse_args()defcount_objects(task)->int:"""All annotation objects of a task: tags, shapes, and tracks."""annotations=task.get_annotations()returnlen(annotations.tags)+len(annotations.shapes)+len(annotations.tracks)defresolve_cloud_storage_id(task,requested_id:int|None)->int:"""The explicitly requested storage, or the one configured in the task."""ifrequested_idisnotNone:returnrequested_idstorage=task.source_storageifnotstorageorstorage.location.value!=Location.CLOUD_STORAGE.value:sys.exit(f"Task {task.id} has no cloud source storage configured; pass --cloud-storage-id")returnstorage.cloud_storage_iddefmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:# 1. The state before the import, to compare against.task=client.tasks.retrieve(args.task_id)print(f"Task {task.id}: {count_objects(task)} objects before import")# 2. Validate the format against the server's list.formats,_=client.api_client.server_api.retrieve_annotation_formats()names=[f.nameforfinformats.importers]ifargs.import_formatnotinnames:sys.exit(f"Unknown import format {args.import_format!r}. Choose one of: {', '.join(names)}")# 3. Where to read from.cloud_storage_id=resolve_cloud_storage_id(task,args.cloud_storage_id)print(f"Reading {args.filename!r} from cloud storage {cloud_storage_id}")# 4. location=cloud_storage makes the server fetch the file itself; the# response only starts a background request, whose id is awaited below._,response=client.api_client.tasks_api.create_annotations(task.id,format=args.import_format,filename=args.filename,location=Location.CLOUD_STORAGE,cloud_storage_id=cloud_storage_id,import_mode=args.import_mode,)rq_id=json.loads(response.data).get("rq_id")ifresponse.dataelseNoneifnotrq_id:sys.exit("The server did not return a request id (rq_id) for the import")try:client.wait_for_completion(rq_id,log_prefix=f"Task {task.id} annotation import")exceptBackgroundRequestExceptionaserror:sys.exit(f"Import of {args.filename!r} from cloud storage {cloud_storage_id} failed: {error}")print(f"Imported {args.filename} as {args.import_format!r} ({args.import_mode})")# 5. Re-read the annotations, so the count is the server's state.print(f"Task {task.id}: {count_objects(task)} objects after import")if__name__=="__main__":main()
Read, edit, and write back annotations
Reads all of a task’s annotations (tags, shapes, and tracks), applies one bulk
edit — move every object from one label to another (--relabel FROM TO) or
delete every object with a given label (--delete-label NAME) — and writes
the edit back with a partial update, so the untouched objects are not
re-uploaded. Prints the per-label object counts before and after.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Read a task's annotations, edit them, and write the edit back: move every
object from one label to another (--relabel) or delete every object with a
given label (--delete-label).
Steps:
1. Retrieve the task and map its label names to ids.
2. Read all annotations (tags, shapes, and tracks) and count objects per label.
3. Write the edit back with a partial annotation update, so the objects that
are not affected by it are not re-uploaded.
4. Re-read the annotations and print the per-label object counts diff.
Usage (run ``python task_edit_annotations.py --help`` for the full list of options):
python task_edit_annotations.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --relabel 'car' 'vehicle'
python task_edit_annotations.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --delete-label 'draft'
"""importargparseimportsysfromcollectionsimportCounterfromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.annotationsimportAnnotationUpdateActiondefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--task-id",type=int,required=True,help="id of an existing task, e.g. 42")action=parser.add_mutually_exclusive_group(required=True)action.add_argument("--relabel",nargs=2,metavar=("FROM","TO"),help="move all objects from label FROM to label TO",)action.add_argument("--delete-label",metavar="NAME",help="delete all objects with this label")returnparser.parse_args()deflabel_counts(annotations,label_names:dict[int,str])->Counter:"""Objects per label name, over tags, shapes, and tracks alike."""returnCounter(label_names[obj.label_id]forobjin[*annotations.tags,*annotations.shapes,*annotations.tracks])defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:task=client.tasks.retrieve(args.task_id)label_ids={label.name:label.idforlabelintask.get_labels()}label_names={id:nameforname,idinlabel_ids.items()}source=args.relabel[0]ifargs.relabelelseargs.delete_labelaffected=set(args.relabel)ifargs.relabelelse{source}fornameinaffected:ifnamenotinlabel_ids:sys.exit(f"Label {name!r} not found in task {task.id}")annotations=task.get_annotations()before=label_counts(annotations,label_names)tags=[tagfortaginannotations.tagsiftag.label_id==label_ids[source]]shapes=[shapeforshapeinannotations.shapesifshape.label_id==label_ids[source]]tracks=[trackfortrackinannotations.tracksiftrack.label_id==label_ids[source]]matched=len(tags)+len(shapes)+len(tracks)ifargs.relabel:target_id=label_ids[args.relabel[1]]task.update_annotations(models.PatchedLabeledDataRequest(tags=[models.LabeledImageRequest(**{**tag.to_dict(),"label_id":target_id})fortagintags],shapes=[models.LabeledShapeRequest(**{**shape.to_dict(),"label_id":target_id})forshapeinshapes],tracks=[models.LabeledTrackRequest(**{**track.to_dict(),"label_id":target_id})fortrackintracks],),action=AnnotationUpdateAction.UPDATE,)print(f"Moved {matched} objects from {source!r} to {args.relabel[1]!r}")else:# An empty id list would make remove_annotations() drop *all* the task# annotations, so skip the request when the label has no objects.ifmatched:task.remove_annotations(ids=[obj.idforobjin[*tags,*shapes,*tracks]])print(f"Deleted {matched} objects with label {source!r}")after=label_counts(task.get_annotations(),label_names)fornameinsorted(affected):print(f" {name}: {before[name]} -> {after[name]}")if__name__=="__main__":main()
Aggregate annotation statistics over a project
Walks every task of a project and counts the annotated objects per label and
per type (a shape type such as rectangle or polygon, tag, or track).
Prints a per-task breakdown with per-label project totals and writes
annotation_stats.csv into the current directory — one row per
(task, label, type).
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Aggregate what was annotated across a project: object counts per label and
per object type for every task, printed and written to a CSV report.
Steps:
1. Retrieve the project and its label names.
2. Walk the project's tasks and read each task's annotations.
3. Count objects per (label, type), where the type is a shape type such as
'rectangle' or 'polygon', 'tag' for tags, or 'track' for tracks.
4. Print a per-task breakdown with per-label project totals, and write
the CSV report to --output.
Usage (run ``python project_annotation_stats.py --help`` for the full list of options):
python project_annotation_stats.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 7 --output annotation_stats.csv
"""importargparseimportcsvfromcollectionsimportCounterfrompathlibimportPathfromcvat_sdkimportmake_clientdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--project-id",type=int,required=True,help="id of an existing project, e.g. 7")parser.add_argument("--output",type=Path,default=Path("annotation_stats.csv"),help="path to write the CSV report to (default: %(default)s)",)returnparser.parse_args()deftask_counts(task,label_names:dict[int,str])->Counter:"""Objects per (label name, object type) in one task."""annotations=task.get_annotations()counts=Counter()fortaginannotations.tags:counts[(label_names[tag.label_id],"tag")]+=1forshapeinannotations.shapes:counts[(label_names[shape.label_id],str(shape.type))]+=1fortrackinannotations.tracks:counts[(label_names[track.label_id],"track")]+=1returncountsdefmain()->None:args=parse_args()report_path=args.outputwithmake_client(args.host,access_token=args.token)asclient:project=client.projects.retrieve(args.project_id)label_names={label.id:label.nameforlabelinproject.get_labels()}tasks=project.get_tasks()label_totals=Counter()total=0withreport_path.open("w",newline="")asf:writer=csv.writer(f)writer.writerow(["task_id","task_name","label","type","count"])fortaskintasks:counts=task_counts(task,label_names)print(f"Task {task.id}{task.name!r}: {sum(counts.values())} objects")for(label,type_),countinsorted(counts.items()):print(f" {label}/{type_}: {count}")writer.writerow([task.id,task.name,label,type_,count])label_totals[label]+=counttotal+=sum(counts.values())print(f"Project {project.id}: {total} objects across {len(tasks)} tasks")forlabel,countinsorted(label_totals.items()):print(f" {label}: {count}")print(f"Wrote {report_path.resolve()}")if__name__=="__main__":main()
Find objects annotated twice
Walks a project’s tasks and reports groups of objects that annotate the same
thing on the same frame. Duplicates appear when an import runs twice, when two
annotators’ job ranges overlap, or after a merge.
Two objects belong to the same group when they sit on the same frame and share
the shape type and the coordinates. The comparison is an exact one: an object
whose coordinates differ is a different object, not a duplicate, so no
similarity threshold is involved. --any-label drops the label condition,
which catches the same car annotated once as car and once as vehicle.
The recipe only reports. Groups are printed and written to duplicates.csv
with one row per object (task_id, job_id, frame, group, label,
type, shape_id, track_id, points). It exits 1 when any group was found,
so it can gate an export pipeline — --no-fail turns that off. Fix what it
reports with task_edit_annotations.py or in the UI.
Every shape type is compared, because comparing coordinates for equality needs
no geometry. Tags are skipped — they have no coordinates. Objects marked
outside are skipped too, and track keyframes are compared alongside plain
shapes, so a shape duplicating a track is reported.
Skeletons are compared using their visible keypoint labels and coordinates,
independent of keypoint order. Skeleton track frames are compared only when
every element has an explicit keyframe on that frame; the recipe does not
interpolate missing keypoints. Skeletons with no visible keypoints are skipped.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--project-id
yes
Id of the project to inspect
--task-id ID [ID ...]
no
Inspect only these tasks of the project; they are retrieved by id, so a big project is not listed
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Find objects annotated twice: objects on the same frame that have the same
label, the same shape type, and exactly the same coordinates.
Duplicates appear when an import runs twice, when two annotators' job ranges
overlap, or after a merge. Shapes whose coordinates differ are different
objects, so the comparison is an exact one and needs no similarity threshold.
The recipe only reports. It exits 1 when it finds a duplicate, so it can gate
an export pipeline; --no-fail turns that off.
Steps:
1. Retrieve the project, its labels, and the tasks to inspect.
2. For each task, read the annotations and the job that owns each frame.
3. Group each frame's objects by (label, type, coordinates) and keep the
groups with more than one member.
4. Print the groups, write the CSV report, and set the exit code.
Usage (run ``python project_find_duplicates.py --help`` for the full list of options):
python project_find_duplicates.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 7
"""importargparseimportcsvimportsysfromcollectionsimportdefaultdictfromdataclassesimportasdict,dataclass,fieldsfromitertoolsimportgroupbyfrompathlibimportPathfromcvat_sdkimportmake_client,models@dataclassclassAnnotated:"""One annotated object, reduced to what the duplicate search compares."""frame:intlabel_id:inttype:strshape_id:int|strtrack_id:int|strpoints:tuple[float,...]elements:tuple[tuple[int,tuple[float,...]],...]=()@dataclassclassDuplicate:"""One member of a duplicate group, as reported and written to the CSV."""task_id:intjob_id:int|strframe:intgroup:intlabel:strtype:strshape_id:int|strtrack_id:int|strpoints:strdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--project-id",type=int,required=True,help="id of an existing project, e.g. 7")parser.add_argument("--task-id",type=int,nargs="+",metavar="ID",help="inspect only these task ids (must belong to the project); ""omit to inspect every task in the project",)parser.add_argument("--any-label",action="store_true",help="also group objects that carry different labels, e.g. the same car ""annotated once as 'car' and once as 'vehicle'",)parser.add_argument("--output",type=Path,default=Path("duplicates.csv"),help="path to write the CSV report to (default: %(default)s)",)parser.add_argument("--no-fail",action="store_true",help="always exit 0, even when duplicates were found")returnparser.parse_args()defiter_objects(annotations):"""The shapes and the track keyframes the recipe compares.
Track keyframes and skeleton keypoints marked `outside` are skipped: they
are intentionally out of view. Tags are skipped too - they have no
coordinates to compare. Skeleton track frames need explicit keyframes for
every element; this recipe does not interpolate missing keypoints.
"""forshapeinannotations.shapes:elements=()ifstr(shape.type)=="skeleton":elements=skeleton_coordinates(shape.elements)ifnotelements:continueyieldAnnotated(frame=shape.frame,label_id=shape.label_id,type=str(shape.type),shape_id=shape.id,track_id="",points=tuple(shape.points),elements=elements,)fortrackinannotations.tracks:forshapeintrack.shapes:ifshape.outside:continueelements=()ifstr(shape.type)=="skeleton":# Element tracks can have independent keyframes. Comparing a# partial pose would require interpolation, outside this recipe.keypoints=[(element.label_id,keyframe)forelementintrack.elementsforkeyframeinelement.shapesifkeyframe.frame==shape.frame]iflen(keypoints)!=len(track.elements):continueelements=tuple(sorted((label_id,tuple(keyframe.points))forlabel_id,keyframeinkeypointsifnotkeyframe.outside))ifnotelements:continueyieldAnnotated(frame=shape.frame,label_id=track.label_id,type=str(shape.type),shape_id=shape.id,track_id=track.id,points=tuple(shape.points),elements=elements,)defskeleton_coordinates(elements:list[models.SubLabeledShape],)->tuple[tuple[int,tuple[float,...]],...]:"""Visible keypoints, keyed by label rather than their serialized order."""returntuple(sorted((element.label_id,tuple(element.points))forelementinelementsifnotelement.outside))defformat_points(points:tuple[float,...],limit:int=8)->str:"""The coordinates as text, cut short: a mask's points are a whole RLE."""head=",".join(f"{value:.2f}"forvalueinpoints[:limit])returnf"{head},..."iflen(points)>limitelseheaddeffind_duplicates(task,label_names:dict[int,str],same_label:bool)->list[Duplicate]:"""The duplicate objects of one task, numbered by group.
Two objects are duplicates when they sit on the same frame and share the
shape type and the coordinates, so the objects can be bucketed by that key
in one pass instead of compared pairwise.
"""job_of_frame={}forjobintask.get_jobs():forframeinrange(job.start_frame,job.stop_frame+1):job_of_frame.setdefault(frame,job.id)groups:dict[tuple,list[Annotated]]=defaultdict(list)forobjiniter_objects(task.get_annotations()):label_part=obj.label_idifsame_labelelseNonegroups[(obj.frame,label_part,obj.type,obj.points,obj.elements)].append(obj)duplicates=[]group_number=0forkeyinsorted(groups,key=lambdakey:key[0]):members=groups[key]iflen(members)<2:continuegroup_number+=1forobjinmembers:duplicates.append(Duplicate(task_id=task.id,job_id=job_of_frame.get(obj.frame,""),frame=obj.frame,group=group_number,label=label_names[obj.label_id],type=obj.type,shape_id=obj.shape_id,track_id=obj.track_id,points=format_points(obj.points),))returnduplicatesdefselect_tasks(client,project,task_ids:list[int]|None)->list:"""The project's tasks, or just the requested ones.
With --task-id the tasks are retrieved by id: listing every task of a large
project only to throw most of them away would be a waste.
"""ifnottask_ids:returnlist(project.get_tasks())tasks=[]fortask_idintask_ids:try:task=client.tasks.retrieve(task_id)exceptException:task=NoneiftaskisNoneortask.project_id!=project.id:sys.exit(f"Task id {task_id} was not found in project {project.id}")tasks.append(task)returntasksdefmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:project=client.projects.retrieve(args.project_id)label_names={label.id:label.nameforlabelinproject.get_labels()}tasks=select_tasks(client,project,args.task_id)ifnottasks:sys.exit(f"Project {project.id} has no tasks to inspect")duplicates:list[Duplicate]=[]fortaskintasks:duplicates.extend(find_duplicates(task,label_names,notargs.any_label))groups=0for_,membersingroupby(duplicates,key=lambdad:(d.task_id,d.group)):members=list(members)first=members[0]groups+=1print(f"duplicate group {first.group} in task {first.task_id}, frame {first.frame}: "f"{len(members)} objects at {first.points}")formemberinmembers:origin=(f"track {member.track_id}"ifmember.track_id!=""elsef"shape {member.shape_id}")print(f" {member.label}{member.type}{origin}")withargs.output.open("w",newline="")asf:writer=csv.DictWriter(f,fieldnames=[field.nameforfieldinfields(Duplicate)])writer.writeheader()writer.writerows(asdict(duplicate)forduplicateinduplicates)print(f"Found {groups} duplicate group(s), {len(duplicates)} object(s)")print(f"Wrote {args.output.resolve()}")ifduplicatesandnotargs.no_fail:sys.exit(1)if__name__=="__main__":main()
Partial update: create, update, or delete only the objects in the request.
Task.remove_annotations(ids=[...])
Delete specific objects by id — or all of them when ids is omitted.
Project.get_annotations()
Read the annotations of every task in a project in one call.
Task.get_frames_info()
Frame names and sizes — useful to report a duplicate by file name rather than by frame index.
Task.get_jobs()
Job frame ranges and states, so a reported duplicate can name the job to fix.
Notes:
An object’s label_id must be a label of the task (or of its project);
task.get_labels() maps names to ids.
Both editing recipes re-read the annotations after writing, so the printed
“after” counts show the server’s state, not the client’s intention.
The duplicate search reads only; Task.remove_annotations(ids=[...]) is what
removes the extra objects once you have decided which copy to keep.
A bucket import is a background request: the POST only returns an rq_id,
and the annotations appear once client.wait_for_completion() returns. A
missing key or wrong credentials surface as a failed request, not as an error
on the POST, so check the request’s message when an import fails.
--filename is the object key as seen from the bucket root, including any
“directory” prefix.
Create validation sets and honeypots, and choose exactly which frames are ground truth
Three recipes for the quality-control side of a task:
task_create_with_validation.py creates a task with a gold set and uploads the
ground truth into it, task_create_with_honeypots.py builds a task whose every
annotation job carries ground truth frames, and task_create_gt_job.py creates
a ground truth job with an exact frame list in a task that already exists.
Create a task with a gold set
Creates the task with validation_params in gt mode, so the validation
frames move into a separate ground truth job that annotators never see. Pick
the frames by name (--gt-frame) or let the server sample them
(--gt-frame-count, reproducible with --random-seed). The recipe then uploads
--gt-annotations into that ground truth job and reports how many objects
landed — after this, quality reports can compare the annotation jobs against it.
The ground truth job’s own frame list is padded with placeholder entries to
mirror the task’s full frame range, so the recipe reads the real validation
frames from the task’s validation layout instead of the job’s frame list.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--image-dir
yes
Directory with the task’s images; every file in it is uploaded
--gt-frame NAME [NAME ...]
one of --gt-frame / --gt-frame-count
Exact ground truth frames
--gt-frame-count N
one of --gt-frame / --gt-frame-count
Randomly sample N ground truth frames
--random-seed
no
Makes --gt-frame-count reproducible
--gt-annotations
no
Annotations file to upload into the ground truth job
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Create a task with a ground truth validation set (a "gold set") and upload
the ground truth annotations into it.
The validation frames are moved into a separate ground truth job, which the
annotators never see. Quality reports compare the annotation jobs against it.
Steps:
1. Collect the files from --image-dir.
2. Create the task with validation_params in "gt" mode: either the exact
frames you name (--gt-frame) or a random sample (--gt-frame-count,
reproducible with --random-seed).
3. Find the created ground truth job and print its frames.
4. Upload --gt-annotations into that job and print how many objects landed.
Usage (run ``python task_create_with_validation.py --help`` for the full list of options):
python task_create_with_validation.py --host 'https://app.cvat.ai' --token '<your token>' \\ --image-dir ./images --gt-frame 'img_001.png' 'img_042.png' \\ --gt-annotations ground_truth.zip --gt-format 'COCO 1.0'
python task_create_with_validation.py --host 'https://app.cvat.ai' --token '<your token>' \\ --image-dir ./images --gt-frame-count 20 --random-seed 42
"""importargparseimportsysfrompathlibimportPathfromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.tasksimportResourceTypedefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--image-dir",type=Path,required=True,help="directory with the task's images; every file in it is uploaded, ""and the server decides which media it accepts",)parser.add_argument("--name",default="Task with a validation set",help="task name")parser.add_argument("--labels",nargs="+",default=["object"],metavar="NAME",help="label names to create (default: %(default)s)",)parser.add_argument("--segment-size",type=int,help="frames per annotation job")# Naming the frames and counting them are two ways to say the same thing,# so argparse rejects a command line that passes both.frames=parser.add_mutually_exclusive_group(required=True)frames.add_argument("--gt-frame",nargs="+",metavar="NAME",help="exact file names to use as ground truth frames",)frames.add_argument("--gt-frame-count",type=int,help="number of randomly chosen ground truth frames")parser.add_argument("--random-seed",type=int,help="seed for --gt-frame-count, for a reproducible split")parser.add_argument("--gt-annotations",type=Path,help="annotations file to upload into the ground truth job")parser.add_argument("--gt-format",default="COCO 1.0",help="importer name for --gt-annotations (default: '%(default)s')",)parser.add_argument("--cleanup",action="store_true",help="delete the created task at the end")returnparser.parse_args()defcollect_images(image_dir:Path)->list[Path]:"""The files to upload, passed as they are found.
The server is the authority on which media formats it supports, so
filtering by extension here would only reject files CVAT can read.
"""images=sorted(pforpinimage_dir.iterdir()ifp.is_file())ifnotimages:sys.exit(f"No files found in {image_dir}")returnimagesdefmain()->None:args=parse_args()images=collect_images(args.image_dir)# 2. "gt" mode puts the ground truth frames into a separate ground truth job.validation_params={"mode":"gt"}ifargs.gt_frame:available={path.nameforpathinimages}unknown=[namefornameinargs.gt_frameifnamenotinavailable]ifunknown:sys.exit(f"Frame(s) {', '.join(unknown)} not in {args.image_dir}")validation_params["frame_selection_method"]="manual"validation_params["frames"]=list(args.gt_frame)else:ifargs.gt_frame_count>=len(images):sys.exit(f"--gt-frame-count must be smaller than the {len(images)} files available")validation_params["frame_selection_method"]="random_uniform"validation_params["frame_count"]=args.gt_frame_countifargs.random_seedisnotNone:validation_params["random_seed"]=args.random_seedwithmake_client(args.host,access_token=args.token)asclient:spec=models.TaskWriteRequest(name=args.name,labels=[models.PatchedLabelRequest(name=name)fornameinargs.labels],**({"segment_size":args.segment_size}ifargs.segment_sizeelse{}),)task=client.tasks.create_from_data(spec=spec,resource_type=ResourceType.LOCAL,resources=images,data_params={"validation_params":validation_params},)print(f"Created task {task.id} with {task.size} frames: {args.host}/tasks/{task.id}")# 3. The ground truth job the server built from validation_params.gt_jobs=client.jobs.list(task_id=task.id,type="ground_truth")ifnotgt_jobs:sys.exit(f"Task {task.id} has no ground truth job; check validation_params")gt_job=gt_jobs[0]layout,_=client.api_client.tasks_api.retrieve_validation_layout(task.id)task_frames=task.get_frames_info()frame_names=[task_frames[index].nameforindexinlayout.validation_frames]print(f"Ground truth job {gt_job.id}: {len(frame_names)} frames")print(f"Ground truth frames: {', '.join(frame_names)}")# 4. Upload the ground truth itself.ifargs.gt_annotations:formats,_=client.api_client.server_api.retrieve_annotation_formats()importers=[f.nameforfinformats.importers]ifargs.gt_formatnotinimporters:sys.exit(f"Unknown import format {args.gt_format!r}. "f"Choose one of: {', '.join(importers)}")gt_job.import_annotations(args.gt_format,args.gt_annotations)annotations=gt_job.get_annotations()count=len(annotations.tags)+len(annotations.shapes)+len(annotations.tracks)print(f"Imported {count} objects into ground truth job {gt_job.id}")else:print("No --gt-annotations given; the ground truth job is empty")ifargs.cleanup:task.remove()print(f"Deleted task {task.id}")else:print("Keeping the task; pass --cleanup to delete it")if__name__=="__main__":main()
Create a task with honeypots
Creates the task with validation_params in gt_pool mode: a validation pool
of ground truth frames, --honeypots-per-job of which are mixed into every
annotation job. Then it prints the layout the server actually built — the pool,
and per job which frame of the job stands in for which pool frame — so you can
see what the annotators will get.
Honeypots need an image task, not a video one. The pool is appended after the
task’s own frames, so the task grows by the injected frames. Because the
resulting jobs no longer have a common length, CVAT stores the per-job frame
lists it built and the task’s segment_size reads back as 0. gt_pool also
requires the task’s frames to be laid out with sorting_method: random, so
annotators cannot learn “this position is always a honeypot” — the recipe sets
this automatically.
To reshuffle the mapping later (useful once annotators start recognizing the
honeypots) or to retire a pool frame whose ground truth turned out to be wrong,
call tasks_api.partial_update_validation_layout() with
frame_selection_method="random_uniform" or with disabled_frames=[...].
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--image-dir
yes
Directory with the task’s images; every file in it is uploaded
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Create a task with honeypots: a pool of ground truth frames, a few of which
are mixed into every annotation job, so each annotator's work can be scored
against known answers without a separate review pass.
Steps:
1. Collect the files from --image-dir.
2. Create the task with validation_params in "gt_pool" mode: the honeypot
frames (--honeypot-frame or --honeypot-frame-count) plus how many of them
each annotation job gets (--honeypots-per-job).
3. Print the layout the server built: the validation pool, and per annotation
job which frame of the job stands in for which pool frame.
Honeypots are only supported by image tasks (not video) with randomly sorted
images, so the script always creates the task with sorting_method="random".
Each annotation job becomes --honeypots-per-job frames longer than --segment-size,
since that many honeypots are injected into it.
Usage (run ``python task_create_with_honeypots.py --help`` for the full list of options):
python task_create_with_honeypots.py --host 'https://app.cvat.ai' --token '<your token>' \\ --image-dir ./images --honeypot-frame-count 20 --honeypots-per-job 2 --segment-size 50
python task_create_with_honeypots.py --host 'https://app.cvat.ai' --token '<your token>' \\ --image-dir ./images --honeypot-frame 'img_001.png' 'img_042.png' --honeypots-per-job 2
"""importargparseimportsysfrompathlibimportPathfromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.tasksimportResourceTypedefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--image-dir",type=Path,required=True,help="directory with the task's images; every file in it is uploaded, ""and the server decides which media it accepts",)parser.add_argument("--name",default="Task with honeypots",help="task name")parser.add_argument("--labels",nargs="+",default=["object"],metavar="NAME",help="label names to create")parser.add_argument("--segment-size",type=int,help="frames per annotation job")# Naming the frames and counting them are two ways to say the same thing,# so argparse rejects a command line that passes both.pool=parser.add_mutually_exclusive_group(required=True)pool.add_argument("--honeypot-frame",nargs="+",metavar="NAME",help="exact file names to use as honeypot frames",)pool.add_argument("--honeypot-frame-count",type=int,help="number of randomly chosen honeypot frames")parser.add_argument("--honeypots-per-job",type=int,required=True,help="honeypot frames mixed into each annotation job",)parser.add_argument("--cleanup",action="store_true",help="delete the created task at the end")returnparser.parse_args()defcollect_images(image_dir:Path)->list[Path]:"""The files to upload, passed as they are found.
The server is the authority on which media formats it supports, so
filtering by extension here would only reject files CVAT can read.
"""images=sorted(pforpinimage_dir.iterdir()ifp.is_file())ifnotimages:sys.exit(f"No files found in {image_dir}")returnimagesdefprint_layout(client,task_id:int)->None:"""The server's honeypot layout: the pool, and job -> (honeypot <- pool frame)."""layout,_=client.api_client.tasks_api.retrieve_validation_layout(task_id)print(f"Validation pool frames: {list(layout.validation_frames)}")real_by_honeypot=dict(zip(layout.honeypot_frames,layout.honeypot_real_frames))forjobinsorted(client.jobs.list(task_id=task_id,type="annotation"),key=lambdaj:j.id):pairs=[f"{honeypot}<-{real}"forhoneypot,realinreal_by_honeypot.items()ifjob.start_frame<=honeypot<=job.stop_frame]print(f" job {job.id} frames {job.start_frame}-{job.stop_frame}: {', '.join(pairs)}")defmain()->None:args=parse_args()images=collect_images(args.image_dir)# 2. "gt_pool" mode injects pool frames into every annotation job.validation_params={"mode":"gt_pool","frames_per_job_count":args.honeypots_per_job,}ifargs.honeypot_frame:available={path.nameforpathinimages}unknown=[namefornameinargs.honeypot_frameifnamenotinavailable]ifunknown:sys.exit(f"Frame(s) {', '.join(unknown)} not in {args.image_dir}")validation_params["frame_selection_method"]="manual"validation_params["frames"]=list(args.honeypot_frame)else:ifargs.honeypot_frame_count>=len(images):sys.exit(f"--honeypot-frame-count must be smaller than the {len(images)} files available")validation_params["frame_selection_method"]="random_uniform"validation_params["frame_count"]=args.honeypot_frame_countwithmake_client(args.host,access_token=args.token)asclient:task=client.tasks.create_from_data(spec=models.TaskWriteRequest(name=args.name,labels=[models.PatchedLabelRequest(name=name)fornameinargs.labels],**({"segment_size":args.segment_size}ifargs.segment_sizeelse{}),),resource_type=ResourceType.LOCAL,resources=images,# "gt_pool" requires the task's frames to be laid out randomly, so# annotators cannot learn "this position is always a honeypot".data_params={"validation_params":validation_params,"sorting_method":"random"},)print(f"Created task {task.id} with {task.size} frames: {args.host}/tasks/{task.id}")# 3. What the server actually built.print_layout(client,task.id)ifargs.cleanup:task.remove()print(f"Deleted task {task.id}")else:print("Keeping the task; pass --cleanup to delete it")if__name__=="__main__":main()
Choose exactly which frames are ground truth
Creates a ground truth job in a task that already exists, with the frames you
name — by index (--frame) or by file name (--frame-name, resolved through
the task’s frame list). A task can hold one ground truth job, so the recipe
refuses to overwrite an existing one unless --replace is passed: deleting a
ground truth job discards its annotations. Afterwards it reads the task’s
validation layout back, so the printed frame list is the server’s.
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Create a ground truth job in an existing task from an exact frame list you choose.
Steps:
1. Retrieve the task and resolve the requested frames: indexes (--frame) or
file names (--frame-name, matched against the task's frame list).
2. Refuse to touch an existing ground truth job unless --replace is given,
because deleting one discards its annotations.
3. Create the ground truth job with the "manual" frame selection method.
4. Read the task's validation layout back and print the frames the server
recorded, so you can see the request landed exactly as asked.
Usage (run ``python task_create_gt_job.py --help`` for the full list of options):
python task_create_gt_job.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --frame 0 17 42
python task_create_gt_job.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 42 --frame-name 'img_001.png' 'img_042.png'
"""importargparseimportsysfromcvat_sdkimportmake_client,modelsdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--task-id",type=int,required=True,help="id of an existing task, e.g. 42")frames=parser.add_mutually_exclusive_group(required=True)frames.add_argument("--frame",type=int,nargs="+",metavar="N",help="frame indexes to use as ground truth")frames.add_argument("--frame-name",nargs="+",metavar="NAME",help="frame file names to use as ground truth")parser.add_argument("--replace",action="store_true",help="delete an existing ground truth job first (discards its annotations)",)returnparser.parse_args()defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:task=client.tasks.retrieve(args.task_id)frames_info=task.get_frames_info()# 1. Resolve the requested frames to task frame indexes.ifargs.frame_name:index_by_name={frame.name:indexforindex,frameinenumerate(frames_info)}unknown=[namefornameinargs.frame_nameifnamenotinindex_by_name]ifunknown:sys.exit(f"Frame name(s) {', '.join(unknown)} not found in task {task.id}")frames=sorted({index_by_name[name]fornameinargs.frame_name})else:out_of_range=[fforfinargs.frameifnot0<=f<len(frames_info)]ifout_of_range:sys.exit(f"Frame(s) {out_of_range} out of range: task {task.id} "f"has {len(frames_info)} frames")frames=sorted(set(args.frame))# 2. An existing ground truth job is never replaced silently.existing=client.jobs.list(task_id=task.id,type="ground_truth")ifexisting:ifnotargs.replace:sys.exit(f"Task {task.id} already has a ground truth job ({existing[0].id}). ""Pass --replace to delete it first - its annotations will be lost.")client.api_client.jobs_api.destroy(existing[0].id)print(f"Deleted the previous ground truth job {existing[0].id}")# 3. "manual" frame selection means: exactly these frames.job,_=client.api_client.jobs_api.create(models.JobWriteRequest(type="ground_truth",task_id=task.id,frame_selection_method="manual",frames=frames,))names=[frames_info[index].nameforindexinframes]print(f"Created ground truth job {job.id} with {len(frames)} frames: {', '.join(names)}")# 4. What the server recorded.layout,_=client.api_client.tasks_api.retrieve_validation_layout(task.id)print(f"Validation frames: {sorted(layout.validation_frames)}")print("Upload the ground truth with: task_create_with_validation.py --gt-annotations ...")if__name__=="__main__":main()
Change the honeypots of one annotation job instead of the whole task.
tasks_api.retrieve_validation_layout(task_id)
Read the pool, honeypots, and disabled frames at any time.
Job.import_annotations(format_name, path)
Upload ground truth into a ground truth job.
Notes:
gt mode moves the ground truth frames into a separate ground truth job;
gt_pool mode copies pool frames into the annotation jobs. Only gt_pool
makes annotators encounter ground truth frames while working.
Ground truth frames are referenced by file name in validation_params and by
frame index in JobWriteRequest and the validation layout API.
Quality reports use whatever the ground truth job holds, so upload the ground
truth before comparing.
Download only what changed, and export many tasks in one run
Two recipes for getting data out of CVAT at scale:
dataset_incremental_download.py keeps a local cache of a project’s tasks and
re-downloads only what the server has changed, and dataset_bulk_export.py
exports a given list of tasks as dataset archives in one go, with support for
resuming local exports. For exporting a single project’s tasks locally and to a bucket, see
project_export_dataset.py.
Export a task or project
The core calls are task.export_dataset(...) and project.export_dataset(...):
Each call downloads one archive, rebuilt by the server every time — there is
no incremental path through export_dataset. The incremental recipe below
uses a different part of the SDK; the bulk recipe adds multi-task exports to
this basic workflow.
Download only what changed
cvat_sdk.datasets.TaskDataset mirrors a task on the local file system and
keeps that copy current. Each time you construct it, the SDK compares the
cached task’s updated_date with the server’s: an unchanged task is served
from disk, a changed one is fetched again. Chunks already cached are never
downloaded twice.
fromcvat_sdk.datasetsimportTaskDataset,UpdatePolicydataset=TaskDataset(client,10,update_policy=UpdatePolicy.IF_MISSING_OR_STALE)forsampleindataset.samples:image=sample.media.load_image()# PIL.Image, from the cacheshapes=sample.annotations.shapes
The cache lives under client.config.cache_dir (a per-user directory by
default), keyed by server host and task id, so several projects and servers can
share one cache without colliding.
Two limits to design around:
Staleness is per task, not per frame. Any change to a task — including an
annotation edit — purges that task’s whole cache entry, so its media is
downloaded again on the next run.
Metadata is always re-fetched. Each run asks the server for the task and
its labels; that request is how staleness is detected. Only chunks and
annotations are skipped when the cache is fresh.
UpdatePolicy.NEVER is the other half of the pair: it reads the cache and
performs no network access at all, failing on anything not already cached. The
recipe exposes it as --offline, which needs explicit --task-id values,
because listing a project’s tasks is itself a server call.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--project-id
one of --project-id / --task-id
Download every task of this project
--task-id ID [ID ...]
one of --project-id / --task-id
Download these task ids
--cache-dir
no
Where the cache goes (default: the SDK’s per-user cache directory)
--offline
no
Use UpdatePolicy.NEVER — read the cache, contact no server; needs --task-id
Run it twice: the second run reports cache grew by 0 B, and the SDK’s log
shows the annotations and chunks coming from the cache rather than the network.
Video tasks are skipped with a message — TaskDataset supports tasks whose
media can be read as images.
The script
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Download a project's task data incrementally: the SDK keeps a local cache and
re-downloads only what the server has changed since the last run.
``cvat_sdk.datasets.TaskDataset`` stores each task under the client's cache
directory. On every construction it compares the cached copy's ``updated_date``
with the server's: an unchanged task is served entirely from disk, a changed one
is fetched again. Media chunks already on disk are never downloaded twice.
Two things worth knowing before building a pipeline on this:
* Staleness is tracked per task, not per frame. Any change to a task - an
annotation edit included - invalidates that task's whole cache entry, so its
media comes down again.
* Every run still asks the server for the task's metadata and labels; that is
how it notices a change. Only the bulky parts - chunks and annotations - are
skipped when the cache is fresh.
Steps:
1. Resolve the tasks to download, from --project-id or from --task-id.
2. Build a TaskDataset for each one, which fills or reuses the cache.
3. Report the samples found and how much the cache grew.
Usage (run ``python dataset_incremental_download.py --help`` for the full list of options):
python dataset_incremental_download.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 7 --cache-dir ./cvat-cache
# run the same command again: the cache does not grow and no media is fetched
python dataset_incremental_download.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 10 11 --cache-dir ./cvat-cache --offline
"""importargparseimportloggingimportsysfrompathlibimportPathfromcvat_sdkimportClient,make_clientfromcvat_sdk.core.clientimportAccessTokenCredentialsfromcvat_sdk.datasetsimportTaskDataset,UnsupportedDatasetError,UpdatePolicydefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)selection=parser.add_mutually_exclusive_group(required=True)selection.add_argument("--project-id",type=int,help="download every task of this project, e.g. 7")selection.add_argument("--task-id",type=int,nargs="+",metavar="ID",help="download these task ids")parser.add_argument("--cache-dir",type=Path,help="where to keep the downloaded data (default: the SDK's per-user cache directory)",)parser.add_argument("--offline",action="store_true",help="read the cache without contacting the server; fails on anything not cached",)parser.add_argument("--quiet",action="store_true",help="hide the SDK's per-file cache and download messages")returnparser.parse_args()defconnect(args:argparse.Namespace)->Client:"""The client to work through.
An --offline run must make no requests at all, so it skips the server
version handshake that Client performs on construction. Applying an access
token needs no round trip either, which is what makes this possible.
"""ifnotargs.offline:returnmake_client(args.host,access_token=args.token)client=Client(url=args.host,check_server_version=False)client.login(AccessTokenCredentials(args.token))returnclientdefcache_size(path:Path)->int:"""Bytes currently cached under path, which need not exist yet."""returnsum(item.stat().st_sizeforiteminpath.rglob("*")ifitem.is_file())defmain()->None:args=parse_args()ifargs.offlineandnotargs.task_id:sys.exit("--offline needs --task-id: listing a project's tasks is itself a server call")logging.basicConfig(level=logging.WARNINGifargs.quietelselogging.INFO,format="%(message)s")withconnect(args)asclient:ifargs.cache_dir:client.config.cache_dir=args.cache_dircache_dir=client.config.cache_dirprint(f"Cache: {cache_dir}")size_before=cache_size(cache_dir)ifargs.task_id:task_ids=args.task_idelse:task_ids=[task.idfortaskinclient.tasks.list(project_id=args.project_id)]ifnottask_ids:sys.exit(f"Project {args.project_id} has no tasks to download")policy=UpdatePolicy.NEVERifargs.offlineelseUpdatePolicy.IF_MISSING_OR_STALEdownloaded=0fortask_idintask_ids:try:dataset=TaskDataset(client,task_id,update_policy=policy)exceptUnsupportedDatasetErroraserror:# A video task, or a task with no data. One such task must not# stop the rest of the selection from being downloaded.print(f"Skipped task {task_id}: {error}")continueexceptFileNotFoundError:print(f"Skipped task {task_id}: not in the cache, run without --offline first")continuedownloaded+=1print(f"Task {task_id}: {len(dataset.samples)} sample(s), {len(dataset.labels)} label(s)")grew=cache_size(cache_dir)-size_beforeprint(f"{downloaded} of {len(task_ids)} task(s) available locally; cache grew by {grew} B")ifnotdownloaded:sys.exit(1)if__name__=="__main__":main()
Export many tasks in one run
Takes an explicit list of task ids, optionally narrowed by status, and
exports each one to a local directory, to a registered cloud storage, or both.
The script prints each result and a summary of exported, skipped, and failed tasks.
One failing task never aborts the run: the script exports the rest and exits 1.
--skip-existing makes an interrupted local run resumable — it takes the
exported file as proof a task is done, so it needs --output-dir and refuses
to pair with --cloud-storage-id, where nothing lands locally to check.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--task-id ID [ID ...]
yes
Export these task ids
--status
no
Keep only tasks in annotation, validation, or completed; applied after the ids are resolved, so an id in another status is reported as filtered out rather than as missing
--output-dir
one of --output-dir / --cloud-storage-id
Local destination
--cloud-storage-id
one of --output-dir / --cloud-storage-id
Cloud destination; checked for existence and access before the run. Every selected task must belong to the storage’s workspace (the same organization, or both in the personal workspace); a mismatch stops the run before any export.
--export-format
no
Exporter name (default 'COCO 1.0')
--skip-existing
no
Skip tasks already exported into --output-dir; local exports only, so it cannot be combined with --cloud-storage-id
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Export many task datasets in one run: name the tasks by id, optionally
narrowed by status, and write them locally and/or straight to a cloud storage.
A failing task does not stop the run - its error is printed and the script
exits with code 1 at the end, so a pipeline still sees the failure.
Steps:
1. Check --cloud-storage-id once, so a wrong id fails before any export, and
resolve the selection (--task-id, --status). Check that every selected
task belongs to the cloud storage's workspace before exporting anything.
2. Export each task to --output-dir and/or to --cloud-storage-id, skipping the
ones already exported when --skip-existing is passed.
3. Report how many tasks were exported, skipped, and failed.
Usage (run ``python dataset_bulk_export.py --help`` for the full list of options):
python dataset_bulk_export.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 10 11 12 --output-dir datasets
python dataset_bulk_export.py --host 'https://app.cvat.ai' --token '<your token>' \\ --task-id 10 11 12 --cloud-storage-id 3 --output-dir datasets
"""importargparseimportsysfrompathlibimportPathfromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.proxies.typesimportLocationdefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--task-id",type=int,nargs="+",metavar="ID",required=True,help="export these task ids",)parser.add_argument("--status",choices=["annotation","validation","completed"],help="export only the tasks in this status",)parser.add_argument("--output-dir",type=Path,help="directory to write the exported datasets to")parser.add_argument("--cloud-storage-id",type=int,help="also export straight to this registered cloud storage, checked before ""the run starts (see cloud_storage_register.py)",)parser.add_argument("--export-format",default="COCO 1.0",help="exporter name, e.g. 'COCO 1.0' (default: '%(default)s')",)parser.add_argument("--skip-existing",action="store_true",help="skip tasks whose output file is already in --output-dir (resume a run); ""local exports only",)parser.add_argument("--with-images",action="store_true",help="include images in the exports")returnparser.parse_args()defselect_tasks(client,args:argparse.Namespace,storage:models.CloudStorageRead|None=None)->list:"""The tasks to export, as (id, name) pairs.
--status is applied after the ids are resolved, so a task that exists but is
in another status is reported as filtered out rather than as missing - two
different mistakes.
"""selected=[]fortask_idinargs.task_id:try:task=client.tasks.retrieve(task_id)exceptException:selected.append((task_id,""))continueifargs.statusandstr(task.status)!=args.status:print(f"Skipping task {task_id}: status is {task.status}, not {args.status}")continueifstorageisnotNoneandtask.organization_id!=storage.organization:sys.exit(f"Task {task_id} and cloud storage {storage.id} belong to different workspaces")selected.append((task.id,task.name))returnselecteddefexport_one(client,args:argparse.Namespace,task_id:int,name:str)->str:local_path=args.output_dir/f"task_{task_id}.zip"ifargs.output_direlseNoneifargs.skip_existingandlocal_pathandlocal_path.exists():print(f"Skipped task {task_id} ({local_path} exists)")return"skipped"try:task=client.tasks.retrieve(task_id)destinations=[]iflocal_path:task.export_dataset(args.export_format,local_path,include_images=args.with_images,location=Location.LOCAL,)destinations.append("local")ifargs.cloud_storage_id:task.export_dataset(args.export_format,f"task_{task_id}.zip",include_images=args.with_images,location=Location.CLOUD_STORAGE,cloud_storage_id=args.cloud_storage_id,)destinations.append(f"cloud storage {args.cloud_storage_id}")print(f"Exported task {task_id}{name!r} -> {', '.join(destinations)}")exceptExceptionaserror:# one bad task must not abort the whole runprint(f"FAILED task {task_id}{name!r}: {type(error).__name__}: {error}")return"failed"return"exported"defmain()->None:args=parse_args()ifnotargs.output_dirandnotargs.cloud_storage_id:sys.exit("Select a destination: pass --output-dir and/or --cloud-storage-id")ifargs.skip_existingandnotargs.output_dir:sys.exit("--skip-existing needs --output-dir: a cloud export leaves nothing local to check")ifargs.skip_existingandargs.cloud_storage_id:sys.exit("--skip-existing cannot resume a cloud export; drop it or drop --cloud-storage-id")ifargs.output_dir:args.output_dir.mkdir(parents=True,exist_ok=True)withmake_client(args.host,access_token=args.token)asclient:storage=Noneifargs.cloud_storage_id:try:storage,_=client.api_client.cloudstorages_api.retrieve(args.cloud_storage_id)exceptExceptionaserror:sys.exit(f"Cloud storage {args.cloud_storage_id} is not available to this user: {error}")print(f"Exporting to cloud storage {storage.id}{storage.display_name!r}")selection=select_tasks(client,args,storage)ifnotselection:sys.exit("The selection is empty; nothing to export")print(f"Exporting {len(selection)} task(s)")results=[export_one(client,args,*task)fortaskinselection]failed=results.count("failed")skipped=results.count("skipped")exported=results.count("exported")print(f"Exported {exported} of {len(results)} task(s); {skipped} skipped, {failed} failed")iffailed:sys.exit(1)if__name__=="__main__":main()
Fetch a chunk only when a sample in it is read, instead of preloading every chunk.
TaskDataset.iter_samples(temporary_chunks=True)
Stream samples through a temporary directory, leaving the shared cache untouched.
TaskDataset(..., load_annotations=False)
Cache media only, when the labels are not needed.
cvat_sdk.pytorch.TaskVisionDataset
The same cache behind a torch.utils.data.Dataset; see the PyTorch adapter.
Notes:
updated_date changes when a task’s fields, data, or annotations change, so it
is what the cache compares against, and why an annotation edit re-downloads
that task’s media too.
Delete the cache directory to force a full re-download.
export_dataset and TaskDataset produce different things: the first a
format-converted archive to hand off, the second a live local mirror to read
frame by frame.
Attach an S3-compatible bucket to CVAT via the low-level cloud storages API
One recipe: cloud_storage_register.py registers an S3-compatible bucket
(AWS S3, MinIO, DigitalOcean Spaces, …) as a CVAT cloud storage. It uses the
low-level client.api_client.cloudstorages_api because there is no high-level
proxy for cloud storages yet.
Attach a bucket to CVAT
Registers a bucket by key/secret, lists all registered storages, retrieves the
new one, lists the bucket’s actual content, and renames it — a smoke test that
the credentials work.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--bucket
yes
Bucket name
--access-key
yes
Bucket access key id
--secret-key
yes
Bucket secret key
--endpoint-url
yes
Endpoint URL, e.g. 'https://s3.amazonaws.com'
--page-size
no
Entries per bucket listing request (default: the server maximum, 500)
--cleanup
no
Detach the bucket from CVAT at the end (data untouched)
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Attach an S3-compatible bucket to CVAT as a cloud storage, then list,
retrieve, and update it. Any S3-compatible service works (AWS S3, minio, ...)
via the AWS_S3_BUCKET provider and a custom endpoint URL.
There is no high-level proxy for cloud storages yet, so this recipe uses the
low-level API (client.api_client.cloudstorages_api).
Steps:
1. Attach the bucket with key/secret credentials to CVAT.
2. List all registered storages.
3. Retrieve the new one.
4. List the bucket's content, a page at a time.
5. Update its display name.
6. Optionally, detach it from CVAT.
Usage (run ``python cloud_storage_register.py --help`` for the full list of options):
python cloud_storage_register.py --host 'https://app.cvat.ai' --token '<your token>' \\ --bucket 'my-bucket' --access-key '<key>' --secret-key '<secret>' \\ --endpoint-url 'https://s3.amazonaws.com'
"""importargparsefromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.helpersimportget_paginated_collectiondefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--bucket",required=True,help="the bucket name, e.g. 'my-bucket'")parser.add_argument("--access-key",required=True,help="the bucket's access key id")parser.add_argument("--secret-key",required=True,help="the bucket's secret key")parser.add_argument("--endpoint-url",required=True,help="e.g. 'https://s3.amazonaws.com' or 'http://minio:9000'",)parser.add_argument("--page-size",type=int,help="entries to fetch per bucket listing request (default: the server's ""maximum, 500); a small value makes the pagination loop visible",)parser.add_argument("--cleanup",action="store_true",help="detach the storage at the end (data is never touched)",)returnparser.parse_args()defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:api=client.api_client.cloudstorages_api# 1. Registerstorage,_=api.create(models.CloudStorageWriteRequest(provider_type="AWS_S3_BUCKET",# any S3-compatible serviceresource=args.bucket,display_name=args.bucket,credentials_type="KEY_SECRET_KEY_PAIR",key=args.access_key,secret_key=args.secret_key,specific_attributes=f"endpoint_url={args.endpoint_url}",))print(f"Registered cloud storage {storage.id} -> {args.bucket}")# 2. List — api.list() returns a single page. Pair it with# get_paginated_collection to walk every page of any low-level list# endpoint (works for tasks_api.list_endpoint, jobs_api.list_endpoint, ...).storages=get_paginated_collection(api.list_endpoint)print(f"Registered storages: {[cs.idforcsinstorages]}")# 3. Retrieve — credentials are never returned, only metadatafetched,_=api.retrieve(storage.id)print(f"Storage {fetched.id}: {fetched.display_name!r} ({fetched.provider_type})")# 4. List the bucket's content, a page at a time via next_token.page_params={"page_size":args.page_size}ifargs.page_sizeelse{}files=[]pages=0next_token=NonewhileTrue:content,_=api.retrieve_content_v2(storage.id,**page_params,**({"next_token":next_token}ifnext_tokenelse{}),)files.extend(content.content)pages+=1ifnotcontent.next:breaknext_token=content.nextprint(f"Bucket {args.bucket!r} contains {len(files)} entries in {pages} page(s):")forfinfiles:print(f" {f.type.value:>3}{f.name}")# 5. Update the display name (PATCH — only the passed fields change)updated,_=api.partial_update(storage.id,patched_cloud_storage_write_request=models.PatchedCloudStorageWriteRequest(display_name=f"{args.bucket} (updated)"),)print(f"Renamed storage {updated.id} to {updated.display_name!r}")# 6. Opt-in cleanup: detaches the bucket from CVAT, never deletes dataifargs.cleanup:api.destroy(storage.id)print(f"Deleted cloud storage {storage.id}")else:print("Keeping the storage; pass --cleanup to delete it")if__name__=="__main__":main()
Other SDK options:
The recipe uses the low-level client.api_client.cloudstorages_api because
there is no high-level proxy for cloud storages yet.
SDK method / parameter
What it adds
models.CloudStorageWriteRequest(description=...)
Free-text description shown alongside the storage.
models.CloudStorageWriteRequest(manifests=[...])
Attach manifest files so CVAT can index large buckets faster.
Alternative credential fields for other providers (e.g. Azure, temporary S3 sessions).
cloudstorages_api.retrieve_status(id=...)
Check whether a registered storage is reachable/healthy.
cloudstorages_api.retrieve_actions(id: int)
Return the operations the credentials allow on the bucket (e.g. "read" / "read,write") as a string. id is the cloud storage id; the string is the returned data (first tuple element).
List the bucket’s actual files/directories. prefix filters to one “directory”; manifest_path lists from a manifest instead of a live bucket scan (faster for large buckets).
cloudstorages_api.retrieve_preview(id: int)
Fetch a preview image for the storage. id is the cloud storage id; the image bytes are on the HTTP response (response.data, the second tuple element), not the parsed data.
Register a webhook for task events and watch new tasks appear live with a local receiver
Two recipes: register_webhook.py creates a webhook for task events on a
project or an organization, pings it, and summarizes its recorded deliveries;
webhook_resource_monitoring.py is the receiving side — it runs a local HTTP
server, registers a webhook pointing at it, verifies each delivery’s signature,
and tallies the tasks created in the project as they arrive.
CVAT signs every delivery with the webhook secret: the X-Signature-256
header carries sha256=<HMAC-SHA256 of the request body>. A receiver that
recomputes and compares the signature (as webhook_resource_monitoring.py
does) can be sure the payload came from the server and not from someone who
merely knows the URL.
Register a webhook and inspect its deliveries
Creates a webhook scoped to a project (--project-id) or a whole organization
(--org), sends a test ping, then lists all recorded deliveries with
get_paginated_collection() and prints how many there are per HTTP status.
There is no high-level proxy for webhooks yet, so the recipe shows the
low-level client.api_client.webhooks_api.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--project-id
one of --project-id / --org
Watch one project
--org SLUG
one of --project-id / --org
Watch a whole organization
--target-url
yes
Where the server delivers the events
--secret
yes
Secret the server signs the deliveries with
--events
no
Events to subscribe to (default: create:task update:task delete:task)
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Register a project- or organization-scoped webhook, send a test ping, and
verify the ping shows up in the webhook's recorded deliveries.
The server signs every delivery with the webhook secret (HMAC-SHA256 in the
'X-Signature-256' header), so the receiver can verify the payload really came
from CVAT — see webhook_resource_monitoring.py for the receiving side.
Steps:
1. Create the webhook: scoped to a project (--project-id) or to a whole
organization (--org).
2. Send a ping — the server POSTs a test payload to --target-url and records
the delivery.
3. List all recorded deliveries and print how many there are per HTTP status.
4. Optionally delete the webhook (--cleanup).
Usage (run ``python register_webhook.py --help`` for the full list of options):
python register_webhook.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 7 --target-url 'https://ci.example.com/cvat-events' --secret 'w3bh00k'
python register_webhook.py --host 'https://app.cvat.ai' --token '<your token>' \\ --org 'annotators' --target-url 'https://ci.example.com/cvat-events' --secret 'w3bh00k'
"""importargparseimportcontextlibfromcollectionsimportCounterfromcvat_sdkimportmake_client,modelsfromcvat_sdk.core.helpersimportget_paginated_collectiondefparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)scope=parser.add_mutually_exclusive_group(required=True)scope.add_argument("--project-id",type=int,help="id of an existing project, e.g. 7")scope.add_argument("--org",metavar="SLUG",help="organization slug to watch as a whole")parser.add_argument("--target-url",required=True,help="where the server delivers the events, e.g. 'https://ci.example.com/cvat-events'",)parser.add_argument("--secret",required=True,help="secret the server signs the deliveries with")parser.add_argument("--events",nargs="+",default=["create:task","update:task","delete:task"],help="events to subscribe to (default: %(default)s)",)parser.add_argument("--content-type",default="application/json",choices=["application/json","application/x-www-form-urlencoded"],help="payload content type the server sends (default: %(default)s)",)parser.add_argument("--cleanup",action="store_true",help="delete the created webhook at the end")returnparser.parse_args()defmain()->None:args=parse_args()withmake_client(args.host,access_token=args.token)asclient:webhooks_api=client.api_client.webhooks_apiifargs.orgisnotNone:scope_context=client.organization_context(args.org)spec=models.WebhookWriteRequest(target_url=args.target_url,type=models.WebhookType("organization"),events=[models.EventsEnum(event)foreventinargs.events],content_type=models.WebhookContentType(args.content_type),secret=args.secret,)scope_label=f"organization {args.org!r}"else:scope_context=contextlib.nullcontext()spec=models.WebhookWriteRequest(target_url=args.target_url,type=models.WebhookType("project"),events=[models.EventsEnum(event)foreventinargs.events],content_type=models.WebhookContentType(args.content_type),secret=args.secret,project_id=args.project_id,)scope_label=f"project {args.project_id}"withscope_context:webhook,_=webhooks_api.create(spec)print(f"Created webhook {webhook.id} for {scope_label} -> {webhook.target_url}")print(f" events: {[str(event)foreventinwebhook.events]}")delivery,_=webhooks_api.create_ping(webhook.id)print(f"Ping delivery: HTTP {delivery.status_codeor'failed'}")# A busy webhook accumulates pages of deliveries; the list endpoint# is paginated like every list in the API, so walk all the pages.deliveries=get_paginated_collection(webhooks_api.list_deliveries_endpoint,id=webhook.id)by_status=Counter(delivery.status_codefordeliveryindeliveries)summary=", ".join(f"{status} x{count}"forstatus,countinsorted(by_status.items()))print(f"Webhook {webhook.id}: {len(deliveries)} deliveries, by status: {summary}")ifargs.cleanup:webhooks_api.destroy(webhook.id)print(f"Deleted webhook {webhook.id}")else:print("Keeping the webhook; pass --cleanup to delete it")if__name__=="__main__":main()
Watch new tasks appear live
Starts a local HTTP server on --port, registers a create:task webhook for
the project targeting --public-url (how the CVAT server reaches this machine
— a public IP, a DNS name, or a tunnel), and then, for every delivery: verifies
the signature, tallies the event, and prints the new task’s id and name. On
Ctrl-C — or after --max-events verified events — it prints the tallies and
how many deliveries were rejected for a bad signature.
Flag
Required
Meaning
--host
yes
Server URL
--token
yes
Personal Access Token
--project-id
yes
Project whose new tasks to watch
--public-url
yes
URL under which the CVAT server can reach this machine
--port
no
Local port to listen on (default 8000)
--secret
yes
Secret the server signs the deliveries with
--max-events
no
Stop after this many verified events (default: run until Ctrl-C)
# Copyright (C) CVAT.ai Corporation## SPDX-License-Identifier: MIT"""Watch a project for newly created tasks via a webhook: register the webhook
pointing at this machine, receive the deliveries with a local HTTP server, and
tally each 'create:task' event.
The server signs every delivery with the webhook secret (HMAC-SHA256 of the
request body in the 'X-Signature-256' header). The receiver recomputes the
signature and rejects deliveries that don't match, so nobody who merely knows
the URL can inject fake events. --public-url is how the CVAT server reaches
this machine (a public IP, a DNS name, or a tunnel), while --port is where the
receiver listens locally.
Steps:
1. Start an HTTP server on --port.
2. Register a webhook for the project's 'create:task' events, targeting
--public-url.
3. For every delivery: verify the signature, then tally the event.
4. On Ctrl-C (or after --max-events deliveries), print the tallies.
5. Optionally delete the webhook (--cleanup).
Usage (run ``python webhook_resource_monitoring.py --help`` for the full list of options):
python webhook_resource_monitoring.py --host 'https://app.cvat.ai' --token '<your token>' \\ --project-id 7 --public-url 'https://my-tunnel.example.com/payload' \\ --port 8000 --secret 'w3bh00k'
"""importargparseimporthashlibimporthmacimportjsonimporturllib.parsefromcollectionsimportCounterfromhttp.serverimportBaseHTTPRequestHandler,HTTPServerfromcvat_sdkimportmake_client,modelsMONITORING_EVENTS=["create:task"]defparse_args()->argparse.Namespace:parser=argparse.ArgumentParser(description=__doc__.split("\n\n")[0])parser.add_argument("--host",required=True,help="CVAT server URL, e.g. 'https://app.cvat.ai'")parser.add_argument("--token",required=True,help="Personal Access Token (CVAT UI: Profile -> Security)",)parser.add_argument("--project-id",type=int,required=True,help="id of an existing project, e.g. 7")parser.add_argument("--public-url",required=True,help="URL under which the CVAT server can reach this machine, ""e.g. 'https://my-tunnel.example.com/payload'",)parser.add_argument("--port",type=int,default=8000,help="local port to listen on (default: %(default)s)")parser.add_argument("--secret",required=True,help="secret the server signs the deliveries with")parser.add_argument("--content-type",default="application/json",choices=["application/json","application/x-www-form-urlencoded"],help="payload content type the server sends (default: %(default)s)",)parser.add_argument("--max-events",type=int,help="stop after this many verified events (default: run until Ctrl-C)",)parser.add_argument("--cleanup",action="store_true",help="delete the created webhook at the end")returnparser.parse_args()classDeliveryHandler(BaseHTTPRequestHandler):"""One CVAT delivery per request: verify the signature, tally the event."""# Set on the subclass by make_handler()secret:bytesevent_counter:Counterrejected:int=0deflog_message(self,format:str,*args)->None:# pylint: disable=redefined-builtinpass# the tallies below replace the default per-request log linedefdo_POST(self)->None:body=self.rfile.read(int(self.headers.get("Content-Length",0)))expected="sha256="+hmac.new(type(self).secret,body,hashlib.sha256).hexdigest()provided=self.headers.get("X-Signature-256","")ifnothmac.compare_digest(expected,provided):type(self).rejected+=1self.send_response(403)self.end_headers()returnself.send_response(200)self.end_headers()# For application/x-www-form-urlencoded, CVAT sends the JSON body under# the 'payload' form field; for application/json, the body is the JSON.content_type=self.headers.get("Content-Type","").split(";",1)[0].strip()ifcontent_type=="application/x-www-form-urlencoded":form=urllib.parse.parse_qs(body.decode("utf-8"))payload=json.loads(form["payload"][0])else:payload=json.loads(body)event_type=payload["event"]ifevent_type=="ping":print("Ping from the server",flush=True)returntype(self).event_counter[event_type]+=1ifevent_type=="create:task":task=payload["task"]print(f" new task {task['id']}: {task.get('name')!r}",flush=True)defmake_handler(secret:str)->type:returntype("Handler",(DeliveryHandler,),{"secret":secret.encode(),"event_counter":Counter()},)defsummarize(counter:Counter)->str:return", ".join(f"{key} x{count}"forkey,countinsorted(counter.items()))or"-"defmain()->None:args=parse_args()handler=make_handler(args.secret)withmake_client(args.host,access_token=args.token)asclient:webhooks_api=client.api_client.webhooks_apiwithHTTPServer(("",args.port),handler)asreceiver:webhook,_=webhooks_api.create(models.WebhookWriteRequest(target_url=args.public_url,type=models.WebhookType("project"),events=[models.EventsEnum(event)foreventinMONITORING_EVENTS],content_type=models.WebhookContentType(args.content_type),secret=args.secret,project_id=args.project_id,))print(f"Created webhook {webhook.id} -> {webhook.target_url}",flush=True)print(f"Listening on port {args.port}; press Ctrl-C to stop",flush=True)try:while(args.max_eventsisNoneorsum(handler.event_counter.values())<args.max_events):receiver.handle_request()exceptKeyboardInterrupt:passprint(f"Received {sum(handler.event_counter.values())} events: "f"{summarize(handler.event_counter)}")print(f"Rejected {handler.rejected} deliveries with a bad signature")ifargs.cleanup:webhooks_api.destroy(webhook.id)print(f"Deleted webhook {webhook.id}")else:print("Keeping the webhook; pass --cleanup to delete it")if__name__=="__main__":main()
Change a webhook’s target, events, or active state in place.
WebhookWriteRequest(..., is_active=False)
Create a webhook disabled, to be enabled later.
WebhookWriteRequest(..., enable_ssl=False)
Skip TLS certificate verification for self-signed receivers.
Notes:
Webhook payloads carry the event name (e.g. update:task), the serialized
resource, and the sender.
An organization webhook lives in the organization’s scope, so every call
about it must be made in that organization’s context
(client.organization_context(slug)).
A third webhook scope, type="server", exists for server-wide events
(user and organization lifecycle events) and is restricted to admin
accounts; it isn’t covered by these two project/organization recipes. See
the Webhooks guide
for details.
The delivery list is paginated like every list endpoint;
get_paginated_collection() walks all the pages.
This package contains manually written and autogenerated files. We store only sources in
the repository. To get the full package, one need to generate missing package files.
API client tests are integrated into REST API tests in /tests/python/rest_api
and SDK tests are placed next to them in /tests/python/sdk.
To execute, run:
pytest tests/python/rest_api tests/python/sdk
SDK API design decisions
The generated ApiClient code is modified from what openapi-generator does by default.
Changes are mostly focused on better user experience - including better
usage patterns and simpler/faster ways to achieve results.
Modifications
Added Python type annotations for return types and class members.
This change required us to implement a custom post-processing script,
which converts generated types into correct type annotations. The types
generated by default are supposed to work with the API implementation
(parameter validation and parsing), but they are not applicable as
type annotations (they have incorrect syntax). Custom post-processing
allowed us to make these types correct type annotations.
Other possible solutions:
There is the python-experimental API generator, which may solve
some issues, but it is unstable and requires python 3.9. Our API
works with 3.7, which is the lowest supported version now.
Custom templates - partially works, but only in limited cases
(model fields). It’s very hard to maintain the template code and
logic for this. Only if checks and for loops are available in
mustache templates, which is not enough for annotation generation.
Separate APIs are embedded into the general APIClient class.
Now we have:
This also required custom post-processing. Operation Ids are
supposed to be unique
in the OpenAPI / Swagger specification. Therefore, we can’t generate such
schema on the server, nor we can’t expect it to be supported in the
API generator.
Operations have IDs like <api>/<method>_<object>.
This also showed to be more readable and more natural than DRF-spectacular’s
default <api>/<object>_<method>.
Server operations have different types for input and output values.
While it can be expected that an endpoint with POST/PUT methods available
(like create or partial_update) has the same type for input and output
(because it looks natural), it also leads to the situation, in which there
are lots of read-/write-only fields, and it becomes hard for understanding.
This clear type separation is supposed to make it simpler for users.
Added cookie management in the ApiClient class.
Added interface classes for models to simplify class member usage and lookup.
Dicts can be passed into API methods and model constructors instead of models.
They are automatically parsed as models. In the original implementation, the user
is required to pass a Configuration object each time, which is clumsy and adds little sense.
3 - Command line interface (CLI)
Overview
A simple command line interface for working with CVAT. At the moment it
implements a basic feature set but may serve as the starting point for a more
comprehensive CVAT administration tool in the future.
The following subcommands are supported:
Projects:
backup - back up a project
create - create a new project
create-from-backup - create a project from a backup file
delete - delete projects
export-dataset - export a project as a dataset
import-dataset - create project tasks from a dataset
ls - list all projects
Tasks:
create - create a new task
create-from-backup - create a task from a backup file
delete - delete tasks
ls - list all tasks
frames - download frames from a task
export-dataset - export a task as a dataset
import-dataset - import annotations into a task from a dataset
backup - back up a task
auto-annotate - automatically annotate a task using a local function
Functions (Enterprise/Cloud only):
create-native - create a function that can be powered by an agent
delete - delete a function
run-agent - process requests for a native function
<common options> are options shared between all subcommands;
<resource> is a CVAT resource, such as task;
<action> is the action to do with the resource, such as create;
<options> is any options specific to a particular resource and action.
You can list available subcommands and options using the --help option:
$ cvat-cli --help # get help on available common options and resources
$ cvat-cli <resource> --help # get help on actions for the given resource
$ cvat-cli <resource> <action> --help # get help on action-specific options
The CLI implements alias subcommands for some task actions, so that,
for example, cvat-cli ls works the same way as cvat-cli task ls. These
aliases are provided for backwards compatibility and are deprecated.
Use the task <action> form instead.
Authentication
CLI supports 2 authentication options:
Personal Access Token (PAT) authentication, with an access token value
Password authentication, with a username and a password
Personal Access Token (PAT) authentication requires a token that can be configured
in the user settings section in the UI. It is the recommended authentication option
for most clients. Read more.
Password authentication requires a username and password pair. For better security it’s
recommended to use a Personal Access Token (PAT) instead, if possible.
A Personal Access Token can only be used via the CVAT_ACCESS_TOKEN environment variable.
This variable is prioritized over other environment variables used for authentication.
exportCVAT_ACCESS_TOKEN="token value"cvat-cli task ls
Credentials can be specified via the --auth global CLI parameter. The password can
be passed after the colon (:) separator or via the PASS environment variable.
For better security, it’s recommended to use the PASS environment variable or
Personal Access Tokens.
cvat-cli --auth "username:password" task ls
exportPASS="password"cvat-cli --auth "username" task ls
The --auth parameter can also be omitted. In this case, the CLI will try to use the current
OS user as the username. If the PASS environment variable is configured, it’s value will be used
for the password. Otherwise, the password will be requested for input.
cvat-cli task ls
Persistent authentication (profiles)
The CLI can remember a server URL and a Personal Access Token (PAT) locally,
so that everyday commands do not have to repeat --server-host / --auth
or leak credentials into shell history. Each remembered profile is
self-contained: it bundles one server with one PAT.
Profiles are stored as a JSON file with 0600 (owner read/write only) mode
inside a 0700 directory. The CLI refuses to read or write the file if
either it or its parent directory is group- or world-accessible. On Windows
the check is best-effort. The location follows the platform convention:
Local profiles are only available for PAT authentication method. Username and password cannot be remembered this way.
Managing profiles
Use cvat-cli profile and cvat-cli config to create and manage profiles.
These commands operate on the local file and do not talk to the server
(except that profile create optionally reads the token’s name from the
server when you did not supply one).
# Save a profile. Prompted for the token (no echo) if omitted.cvat-cli --server-host https://app.cvat.ai profile create --name mycvat --set-default
# Save a profile by pasting the token, and pick a nickname:cvat-cli --server-host https://app.cvat.ai profile create --name mycvat "<paste-token-here>"# Import a plain-text token:cvat-cli --server-host https://app.cvat.ai profile create --name mycvat --file ~/Downloads/cvat-token.txt
# A JSONC envelope containing the token, server, and profile name needs no extra arguments:cvat-cli profile create --file ~/Downloads/cvat-token-my-laptop.json
# Inspect and manage the store:cvat-cli profile list # lists names, servers, and the default markercvat-cli profile list --names-only # names only, one per line (script-friendly)cvat-cli profile default # print the current default profilecvat-cli profile default staging # make "staging" the defaultcvat-cli profile default --unset # unset the defaultcvat-cli profile delete staging # remove the profile (does not revoke the token)# Set a fallback server used when neither --server-host nor --profile is given:cvat-cli config default-server https://app.cvat.ai
cvat-cli config default-server # print the current default servercvat-cli config default-server --unset
Token envelope files accept JSONC syntax, including comments and trailing
commas. If the server has moved since the envelope was downloaded, pass
--server-host to override the embedded server URL:
The server-side token is not revoked when a profile is deleted; use the
CVAT UI or API to revoke it.
Selecting a profile per command
The global --profile <name> flag selects a saved profile for a single
command. It is mutually exclusive with --server-host, --server-port,
and --auth:
cvat-cli --profile mycvat task ls
cvat-cli --profile staging task create "task 1" --labels labels.json local file.jpg
Resolution order
The CLI first tries to select a profile:
An explicit --profile NAME, if provided. It supplies both the server and
PAT, and cannot be combined with --server-host, --server-port, or
--auth.
Otherwise, the default profile, if one is configured and no explicit
server or credential was provided. CVAT_ACCESS_TOKEN counts as an
explicit credential.
If a profile is selected, it supplies both values and resolution stops.
Otherwise, the credential and server are resolved independently.
Credential resolution order:
--auth USER[:PASS], if provided. When PASS is omitted, the CLI uses
the PASS environment variable or prompts for the password.
CVAT_ACCESS_TOKEN, if set.
The current OS username, with the PASS environment variable or a
password prompt.
Server resolution order:
--server-host, if provided. --server-port is applied to the selected
host; if only --server-port is provided, the host comes from the next
available source below.
The server configured by cvat-cli config default-server, if set.
The built-in default, http://localhost.
Supplying an explicit credential or server prevents the CLI from borrowing
the other value from the default profile.
Create a task named “new task” on the default server http://localhost, labels from the file “labels.json”
and local images “file1.jpg” and “file2.jpg”, the task will be created as current user:
cvat-cli task create "new task" --labels labels.json local file1.jpg file2.jpg
Create a task named “task 1” on the server https://example.com labels from the file “labels.json”
and local image “image1.jpg”, the task will be created as user “user-1”:
Create a task named “task 1” on the default server, with labels from “labels.json”
and local image “file1.jpg”, as the current user, in organization “myorg”:
Create a task named “task 1 sort random”, with labels “cat” and “dog”, with chunk size 8,
with sorting-method random, frame step 10, copy the data on the CVAT server,
with use zip chunks and the video file will be taken from the shared resource:
Create a task named “task from dataset_1”, labels from the file “labels.json”, with link to bug tracker,
image quality will be reduced to 75, annotation in the format “CVAT 1.1” will be taken
from the file “annotation.xml”, the data will be loaded from “dataset_1/images/”,
the task will be created as user “user-2”, and the password will need to be entered additionally:
Create a task named “segmented task 1”, labels from the file “labels.json”, with overlay size 5,
segment size 100, with frames 5 through 705, using cache and with a remote video file:
Create a task named “task with filtered cloud storage data”, with filename_pattern test_images/*.jpeg
and using the data from the cloud storage resource described in the manifest.jsonl:
Create a task named “task with filtered cloud storage data” using all data from the cloud storage resource
described in the manifest.jsonl by specifying filename_pattern *:
As a Python module implementing a factory function named create.
This function must return an object implementing the AA function protocol.
Any parameters specified on the command line using the -p option
will be passed to create.
Note that this command does not modify the Python module search path.
If your function module needs to import other local modules,
you must add your module directory to the search path
if it isn’t there already.
Annotate the task with id 139 with a function defined in the my_func module
located in the my-project directory,
letting it import other modules from that directory.
While creating a project, you may optionally define its labels.
The project create command accepts labels in the same format as the task create command;
see that command’s examples for more information.
Create a project named “new project” on the default server http://localhost,
with labels from the file “labels.json”:
cvat-cli project create "new project" --labels labels.json
Create a project from a dataset in the COCO format:
cvat-cli project create "new project" --dataset_path coco.zip --dataset_format "COCO 1.0"
Create a project from a dataset and check the import status every second:
The project must have labels compatible with the dataset being imported. The uploaded dataset
must include image data, because the command creates new tasks with images and annotations.
Examples - functions
Note: The functionality described in this section can only be used
with the CVAT Enterprise or CVAT Cloud.
Create
Create a function that uses a detection model from torchvision
and run an agent for it:
cvat-cli function create-native "Faster R-CNN" \
--function-module cvat_sdk.auto_annotation.functions.torchvision_detection \
-p model_name=str:fasterrcnn_resnet50_fpn_v2
cvat-cli function run-agent <ID printed by previous command> \
--function-module cvat_sdk.auto_annotation.functions.torchvision_detection \
-p model_name=str:fasterrcnn_resnet50_fpn_v2
Create and run an SAM2 tracking function:
cvat-cli function create-native "SAM2" \
--function-file=<CVAT_DIR>/ai-models/tracker/sam2/func.py \
-p model_id=str:facebook/sam2.1-hiera-tiny
cvat-cli function run-agent <ID printed by previous command> \
--function-file=<CVAT_DIR>/ai-models/tracker/sam2/func.py \
-p model_id=str:facebook/sam2.1-hiera-tiny
These commands accept functions that implement the
auto-annotation function interface
from the SDK, same as the task auto-annotate command.
See that command’s examples for information on how to implement these functions
and specify them in the command line.
Use access tokens for enhanced security when integrating with CVAT API
Overview
When interacting with the API, there are several authentication options available in CVAT:
Basic authentication, with a username and a password
Legacy token authentication, with an API key (deprecated)
Session authentication, with a session ID and a CSRF token
Personal Access Token (PAT) authentication, with an access token value
Personal Access Token (PAT) is an authentication option dedicated to CLI, SDK and Server API
clients. To authenticate using this method, you need an access token that can be created and
configured in the user settings section in the UI. It is the recommended authentication option
for CVAT API interaction and integrations.
Compared to the other authentication options, PATs provide a more convenient, controlled,
and secure way to authenticate requests from the CLI, scripts, and 3rd-party applications.
They improve the security of your account by allowing you to use separate credentials
for each application and by removing the need to use the password. Tokens can be created and
revoked at any time by a user request. The security is further improved
by configuring the allowed operations and setting expiration dates for each token.
Warning
Please take special care to store the tokens securely. While CVAT takes extra steps to improve
the security of the tokens, their security is primarily the user’s responsibility.
It’s recommended to configure each token to only allow the required operations and to have an
expiration date. Avoid sharing your tokens with other people. If you think a token might
have been leaked, revoke the token immediately.
How to manage Personal Access Tokens
It’s possible to create, edit, and revoke tokens. The tokens can be created, edited, and revoked
at any time by a user request. You can configure the name, expiration date, and permissions
for each token.
It’s recommended to always specify the expiration date for tokens. Please note that unused tokens
are automatically considered “stale” and removed after some time period
of inactivity (1 year by default).
Note
When using a self-hosted version, the staleness period can be configured
via the ACCESS_TOKEN_STALE_PERIOD setting.
Note
When using a self-hosted version, the maximum number of tokens per user can be configured
via the MAX_ACCESS_TOKENS_PER_USER setting.
Note
CVAT Online users can have up to 50 Personal Access Tokens.
Permissions
It’s possible to configure allowed operations for a token. Currently, there is an option to
make a token read-only or read/write capable. A read-only token will only be allowed to make safe requests
that do not modify the server state.
Warning
For security reasons, token-authenticated clients are not allowed to modify tokens
and user details, regardless of the configuration.
How to create a Personal Access Token
Open the user settings page
Navigate to the “Security” section
Create a new token using the “+” button
Configure the name, expiration date, and permissions for the new token. Once ready, click “Save”.
You will be shown the new token. Make sure to securely save this value,
it will not be available in CVAT after the dialog window is closed.
Once the value is saved, close the dialog window.
The new token is ready for use.
How to edit a Personal Access Token
Open the user settings page
Navigate to the “Security” section
Click the “Edit” button for the token.
The token editing page will be displayed. Here you can configure token name,
permissions, and expiration date.
After the required changes are made, click the “Update” button to confirm the updates.
How to revoke Personal Access Tokens
Revocation allows you to prevent further uses of a token. Once a token is revoked, it cannot
be restored.
Open the user settings page
Navigate to the “Security” section
Click the “Revoke” button for the token.
Confirm revocation in the dialog
The token will not be available for use anymore.
How to use Personal Access Tokens
Once you have a Personal Access Token, it can be used for authentication in CVAT.
To authenticate a server HTTP API request with a token, the Authorization header
must be specified. The value has to include the Bearer prefix:
Authorization: Bearer token_value.
Example: sending a request via the requests Python library